PDB entry 6fr4

View 6fr4 on RCSB PDB site
Description: 003 TCR Study of CDR Loop Flexibility
Class: immune system
Keywords: 003 TCR, CDR Flexibility, Immune system, 3D Structure, MHC Class I
Deposited on 2018-02-15, released 2018-04-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-18, with a file datestamp of 2018-04-13.
Experiment type: XRAY
Resolution: 1.28 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TCR 003 alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6NSA1 (1-201)
      • initiating methionine (0)
      • conflict (1-2)
      • conflict (5)
      • conflict (7)
      • conflict (9-10)
      • conflict (17-20)
      • conflict (24-27)
      • conflict (30-34)
      • conflict (36)
      • conflict (39-41)
      • insertion (44)
      • conflict (45-46)
      • conflict (49-52)
      • conflict (54-59)
      • conflict (62-63)
      • conflict (65-66)
      • conflict (71-74)
      • conflict (76)
      • conflict (78-79)
      • conflict (83)
      • conflict (92-95)
      • conflict (97)
      • conflict (102)
      • conflict (105)
      • conflict (107)
      • conflict (109)
      • conflict (158)
    Domains in SCOPe 2.07: d6fr4a1, d6fr4a2
  • Chain 'B':
    Compound: TCR 003 Beta Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FR4 (0-243)
    Domains in SCOPe 2.07: d6fr4b1, d6fr4b2
  • Heterogens: GOL, EDO, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fr4A (A:)
    mkqevtqipaalsvpegenlvlncsftdsaiynlqwfrqdpgkgltsllliqssqreqts
    grlnasldkssgrstlyiaasqpgdsatylcavtnfnkfyfgsgtklnvkpniqnpdpav
    yqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnks
    dfacanafnnsiipedtffpsp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fr4B (B:)
    mkagvtqtpryliktrgqqvtlscspisghrsvswyqqtpgqglqflfeyfsetqrnkgn
    fpgrfsgrqfsnsrsemnvstlelgdsalylcassfdsgnsplhfgngtrltvtedlnkv
    fppevavfepseaeishtqkatlvclatgffpdhvelswwvngkevhsgvctdpqplkeq
    palndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeaw
    grad