PDB entry 6fqy

View 6fqy on RCSB PDB site
Description: Plasmodium falciparum 6-phosphogluconate dehydrogenase in its apo form, in complex with its cofactor NADP+ and in complex with its substrate 6-phosphogluconate
Class: oxidoreductase
Keywords: Plasmodium, complex, substrate, redoxregulation, OXIDOREDUCTASE
Deposited on 2018-02-15, released 2018-08-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-22, with a file datestamp of 2018-08-17.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 6-phosphogluconate dehydrogenase, decarboxylating
    Species: Plasmodium falciparum [TaxId:36329]
    Gene: PF14_0520, PF3D7_1454700
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fqya1, d6fqya2
  • Chain 'B':
    Compound: 6-phosphogluconate dehydrogenase, decarboxylating
    Species: Plasmodium falciparum [TaxId:36329]
    Gene: PF14_0520, PF3D7_1454700
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fqyb1, d6fqyb2
  • Heterogens: NAP, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fqyA (A:)
    mcdigliglavmgqnlslnisskgfkigvynrtyerteetmkrakeenlvvygyktveel
    innlkkprkvillikagpavdenisnilkhfekgdiiidggnewyinserriklckekdv
    eylamgvsggeagarygcsfmpggskyaydcvkeilekcsaqvgnspcvtyigpgssgny
    vkmvhngieygdmqlisesyvimkhilkydnqklsevfnkwnegilnsylieitanilak
    kddltnnylvdmildiagakgtgkwtmleatergipcptmcaaldarnisvfkelrtkae
    snfnkdnilidpnedlndfendllnalycckiisytqglfllkqvseemnwklnlgeiar
    iwrggciiravfldrianayknneklellfldnefsddiknklpslrkivlmatkysipi
    pafsaslayfqmvtsqnlplnlvqaqrdyfgshtyrrtdregnyhtlw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6fqyB (B:)
    mcdigliglavmgqnlslnisskgfkigvynrtyerteetmkrakeenlvvygyktveel
    innlkkprkvillikagpavdenisnilkhfekgdiiidggnewyinserriklckekdv
    eylamgvsggeagarygcsfmpggskyaydcvkeilekcsaqvgnspcvtyigpgssgny
    vkmvhngieygdmqlisesyvimkhilkydnqklsevfnkwnegilnsylieitanilak
    kddltnnylvdmildiagakgtgkwtmleatergipcptmcaaldarnisvfkelrtkae
    snfnkdnilidpnedlndfendllnalycckiisytqglfllkqvseemnwklnlgeiar
    iwrggciiravfldrianayknneklellfldnefsddiknklpslrkivlmatkysipi
    pafsaslayfqmvtsqnlplnlvqaqrdyfgshtyrrtdregnyhtlw
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fqyB (B:)
    cdigliglavmgqnlslnisskgfkigvynrtyerteetmkrakeenlvvygyktveeli
    nnlkkprkvillikagpavdenisnilkhfekgdiiidggnewyinserriklckekdve
    ylamgvsggeagarygcsfmpggskyaydcvkeilekcsaqvgnspcvtyigpgssgnyv
    kmvhngieygdmqlisesyvimkhilkydnqklsevfnkwnegilnsylieitanilakk
    ddltnnylvdmildiagakgtgkwtmleatergipcptmcaaldarnisvfkelrtkaes
    nfnkdnilidpnedlndfendllnalycckiisytqglfllkqvseemnwklnlgeiari
    wrggciiravfldrianayknneklellfldnefsddiknklpslrkivlmatkysipip
    afsaslayfqmvtsqnlplnlvqaqrdyfgshtyrrtdregnyhtlw