PDB entry 6fqx

View 6fqx on RCSB PDB site
Description: Plasmodium falciparum 6-phosphogluconate dehydrogenase in its apo form, in complex with its cofactor NADP+ and in complex with its substrate 6-phosphogluconate
Class: oxidoreductase
Keywords: Plasmodium, complex, substrate, redoxregulation, OXIDOREDUCTASE
Deposited on 2018-02-15, released 2018-08-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-22, with a file datestamp of 2018-08-17.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 6-phosphogluconate dehydrogenase, decarboxylating
    Species: Plasmodium falciparum 3D7 [TaxId:36329]
    Gene: PF14_0520, PF3D7_1454700
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fqxa1, d6fqxa2
  • Chain 'B':
    Compound: 6-phosphogluconate dehydrogenase, decarboxylating
    Species: Plasmodium falciparum 3D7 [TaxId:36329]
    Gene: PF14_0520, PF3D7_1454700
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fqxb1, d6fqxb2
  • Chain 'C':
    Compound: 6-phosphogluconate dehydrogenase, decarboxylating
    Species: Plasmodium falciparum 3D7 [TaxId:36329]
    Gene: PF14_0520, PF3D7_1454700
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fqxc1, d6fqxc2
  • Chain 'D':
    Compound: 6-phosphogluconate dehydrogenase, decarboxylating
    Species: Plasmodium falciparum 3D7 [TaxId:36329]
    Gene: PF14_0520, PF3D7_1454700
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fqxd1, d6fqxd2
  • Chain 'E':
    Compound: 6-phosphogluconate dehydrogenase, decarboxylating
    Species: Plasmodium falciparum 3D7 [TaxId:36329]
    Gene: PF14_0520, PF3D7_1454700
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fqxe1, d6fqxe2
  • Chain 'F':
    Compound: 6-phosphogluconate dehydrogenase, decarboxylating
    Species: Plasmodium falciparum 3D7 [TaxId:36329]
    Gene: PF14_0520, PF3D7_1454700
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fqxf1, d6fqxf2
  • Chain 'G':
    Compound: 6-phosphogluconate dehydrogenase, decarboxylating
    Species: Plasmodium falciparum 3D7 [TaxId:36329]
    Gene: PF14_0520, PF3D7_1454700
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fqxg1, d6fqxg2
  • Chain 'H':
    Compound: 6-phosphogluconate dehydrogenase, decarboxylating
    Species: Plasmodium falciparum 3D7 [TaxId:36329]
    Gene: PF14_0520, PF3D7_1454700
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fqxh1, d6fqxh2
  • Heterogens: GOL, PEG, PGE, AE3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fqxA (A:)
    mcdigliglavmgqnlslnisskgfkigvynrtyerteetmkrakeenlvvygyktveel
    innlkkprkvillikagpavdenisnilkhfekgdiiidggnewyinserriklckekdv
    eylamgvsggeagarygcsfmpggskyaydcvkeilekcsaqvgnspcvtyigpgssgny
    vkmvhngieygdmqlisesyvimkhilkydnqklsevfnkwnegilnsylieitanilak
    kddltnnylvdmildiagakgtgkwtmleatergipcptmcaaldarnisvfkelrtkae
    snfnkdnilidpnedlndfendllnalycckiisytqglfllkqvseemnwklnlgeiar
    iwrggciiravfldrianayknneklellfldnefsddiknklpslrkivlmatkysipi
    pafsaslayfqmvtsqnlplnlvqaqrdyfgshtyrrtdregnyhtlw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fqxB (B:)
    mcdigliglavmgqnlslnisskgfkigvynrtyerteetmkrakeenlvvygyktveel
    innlkkprkvillikagpavdenisnilkhfekgdiiidggnewyinserriklckekdv
    eylamgvsggeagarygcsfmpggskyaydcvkeilekcsaqvgnspcvtyigpgssgny
    vkmvhngieygdmqlisesyvimkhilkydnqklsevfnkwnegilnsylieitanilak
    kddltnnylvdmildiagakgtgkwtmleatergipcptmcaaldarnisvfkelrtkae
    snfnkdnilidpnedlndfendllnalycckiisytqglfllkqvseemnwklnlgeiar
    iwrggciiravfldrianayknneklellfldnefsddiknklpslrkivlmatkysipi
    pafsaslayfqmvtsqnlplnlvqaqrdyfgshtyrrtdregnyhtlw
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fqxC (C:)
    mcdigliglavmgqnlslnisskgfkigvynrtyerteetmkrakeenlvvygyktveel
    innlkkprkvillikagpavdenisnilkhfekgdiiidggnewyinserriklckekdv
    eylamgvsggeagarygcsfmpggskyaydcvkeilekcsaqvgnspcvtyigpgssgny
    vkmvhngieygdmqlisesyvimkhilkydnqklsevfnkwnegilnsylieitanilak
    kddltnnylvdmildiagakgtgkwtmleatergipcptmcaaldarnisvfkelrtkae
    snfnkdnilidpnedlndfendllnalycckiisytqglfllkqvseemnwklnlgeiar
    iwrggciiravfldrianayknneklellfldnefsddiknklpslrkivlmatkysipi
    pafsaslayfqmvtsqnlplnlvqaqrdyfgshtyrrtdregnyhtlw
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fqxD (D:)
    mcdigliglavmgqnlslnisskgfkigvynrtyerteetmkrakeenlvvygyktveel
    innlkkprkvillikagpavdenisnilkhfekgdiiidggnewyinserriklckekdv
    eylamgvsggeagarygcsfmpggskyaydcvkeilekcsaqvgnspcvtyigpgssgny
    vkmvhngieygdmqlisesyvimkhilkydnqklsevfnkwnegilnsylieitanilak
    kddltnnylvdmildiagakgtgkwtmleatergipcptmcaaldarnisvfkelrtkae
    snfnkdnilidpnedlndfendllnalycckiisytqglfllkqvseemnwklnlgeiar
    iwrggciiravfldrianayknneklellfldnefsddiknklpslrkivlmatkysipi
    pafsaslayfqmvtsqnlplnlvqaqrdyfgshtyrrtdregnyhtlw
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fqxE (E:)
    mcdigliglavmgqnlslnisskgfkigvynrtyerteetmkrakeenlvvygyktveel
    innlkkprkvillikagpavdenisnilkhfekgdiiidggnewyinserriklckekdv
    eylamgvsggeagarygcsfmpggskyaydcvkeilekcsaqvgnspcvtyigpgssgny
    vkmvhngieygdmqlisesyvimkhilkydnqklsevfnkwnegilnsylieitanilak
    kddltnnylvdmildiagakgtgkwtmleatergipcptmcaaldarnisvfkelrtkae
    snfnkdnilidpnedlndfendllnalycckiisytqglfllkqvseemnwklnlgeiar
    iwrggciiravfldrianayknneklellfldnefsddiknklpslrkivlmatkysipi
    pafsaslayfqmvtsqnlplnlvqaqrdyfgshtyrrtdregnyhtlw
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fqxF (F:)
    mcdigliglavmgqnlslnisskgfkigvynrtyerteetmkrakeenlvvygyktveel
    innlkkprkvillikagpavdenisnilkhfekgdiiidggnewyinserriklckekdv
    eylamgvsggeagarygcsfmpggskyaydcvkeilekcsaqvgnspcvtyigpgssgny
    vkmvhngieygdmqlisesyvimkhilkydnqklsevfnkwnegilnsylieitanilak
    kddltnnylvdmildiagakgtgkwtmleatergipcptmcaaldarnisvfkelrtkae
    snfnkdnilidpnedlndfendllnalycckiisytqglfllkqvseemnwklnlgeiar
    iwrggciiravfldrianayknneklellfldnefsddiknklpslrkivlmatkysipi
    pafsaslayfqmvtsqnlplnlvqaqrdyfgshtyrrtdregnyhtlw
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fqxG (G:)
    mcdigliglavmgqnlslnisskgfkigvynrtyerteetmkrakeenlvvygyktveel
    innlkkprkvillikagpavdenisnilkhfekgdiiidggnewyinserriklckekdv
    eylamgvsggeagarygcsfmpggskyaydcvkeilekcsaqvgnspcvtyigpgssgny
    vkmvhngieygdmqlisesyvimkhilkydnqklsevfnkwnegilnsylieitanilak
    kddltnnylvdmildiagakgtgkwtmleatergipcptmcaaldarnisvfkelrtkae
    snfnkdnilidpnedlndfendllnalycckiisytqglfllkqvseemnwklnlgeiar
    iwrggciiravfldrianayknneklellfldnefsddiknklpslrkivlmatkysipi
    pafsaslayfqmvtsqnlplnlvqaqrdyfgshtyrrtdregnyhtlw
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fqxH (H:)
    mcdigliglavmgqnlslnisskgfkigvynrtyerteetmkrakeenlvvygyktveel
    innlkkprkvillikagpavdenisnilkhfekgdiiidggnewyinserriklckekdv
    eylamgvsggeagarygcsfmpggskyaydcvkeilekcsaqvgnspcvtyigpgssgny
    vkmvhngieygdmqlisesyvimkhilkydnqklsevfnkwnegilnsylieitanilak
    kddltnnylvdmildiagakgtgkwtmleatergipcptmcaaldarnisvfkelrtkae
    snfnkdnilidpnedlndfendllnalycckiisytqglfllkqvseemnwklnlgeiar
    iwrggciiravfldrianayknneklellfldnefsddiknklpslrkivlmatkysipi
    pafsaslayfqmvtsqnlplnlvqaqrdyfgshtyrrtdregnyhtlw