PDB entry 6fqv

View 6fqv on RCSB PDB site
Description: 2.60a binary complex of s.aureus gyrase with uncleaved dna
Deposited on 2018-02-14, released 2018-04-04
The last revision was dated 2018-05-16, with a file datestamp of 2018-05-11.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA gyrase subunit A
    Species: Staphylococcus aureus (strain N315) [TaxId:158879]
    Gene: gyrA, SA0006
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: DNA gyrase subunit B,DNA gyrase subunit B
    Species: Staphylococcus aureus (strain N315) [TaxId:158879]
    Gene: gyrB, SA0005
    Database cross-references and differences (RAF-indexed):
    • Uniprot P66937 (Start-134)
      • linker (135-136)
    • Uniprot P66937 (137-End)
  • Chain 'C':
    Compound: DNA gyrase subunit A
    Species: Staphylococcus aureus (strain N315) [TaxId:158879]
    Gene: gyrA, SA0006
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: DNA gyrase subunit B,DNA gyrase subunit B
    Species: Staphylococcus aureus (strain N315) [TaxId:158879]
    Gene: gyrB, SA0005
    Database cross-references and differences (RAF-indexed):
    • Uniprot P66937 (Start-134)
      • linker (135-136)
    • Uniprot P66937 (137-End)
  • Chain 'E':
    Compound: DNA (5'-d(*gp*ap*gp*cp*gp*tp*ap*cp*gp*gp*cp*cp*gp*tp*ap*cp*gp*cp*tp*t)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'F':
    Compound: DNA (5'-d(*gp*ap*gp*cp*gp*tp*ap*cp*gp*gp*cp*cp*gp*tp*ap*cp*gp*cp*tp*t)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'R':
    Compound: DNA gyrase subunit A
    Species: Staphylococcus aureus (strain N315) [TaxId:158879]
    Gene: gyrA, SA0006
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: DNA gyrase subunit B,DNA gyrase subunit B
    Species: Staphylococcus aureus (strain N315) [TaxId:158879]
    Gene: gyrB, SA0005
    Database cross-references and differences (RAF-indexed):
    • Uniprot P66937 (Start-134)
      • linker (135-136)
    • Uniprot P66937 (137-End)
  • Chain 'T':
    Compound: DNA gyrase subunit A
    Species: Staphylococcus aureus (strain N315) [TaxId:158879]
    Gene: gyrA, SA0006
    Database cross-references and differences (RAF-indexed):
  • Chain 'U':
    Compound: DNA gyrase subunit B,DNA gyrase subunit B
    Species: Staphylococcus aureus (strain N315) [TaxId:158879]
    Gene: gyrB, SA0005
    Database cross-references and differences (RAF-indexed):
    • Uniprot P66937 (Start-134)
      • linker (135-136)
    • Uniprot P66937 (137-End)
  • Chain 'V':
    Compound: DNA (5'-d(*gp*ap*gp*cp*gp*tp*ap*cp*gp*gp*cp*cp*gp*tp*ap*cp*gp*cp*tp*t)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'W':
    Compound: DNA (5'-d(*gp*ap*gp*cp*gp*tp*ap*cp*gp*gp*cp*cp*gp*tp*ap*cp*gp*cp*tp*t)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Heterogens: GOL, SO4, NA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6fqvA (A:)
    aelpqsrinernitsemresfldyamsvivaralpdvrdglkpvhrrilyglneqgmtpd
    ksykksarivgdvmgkyhphgdssiyeamvrmaqdfsyryplvdgqgnfgsmdgdgaaam
    rytearmtkitlellrdinkdtidfidnydgnerepsvlparfpnllangasgiavgmat
    nipphnltelingvlslsknpdisiaelmediegpdfptaglilgksgirrayetgrgsi
    qmrsravieergggrqrivvteipfqvnkarmiekiaelvrdkkidgitdlrdetslrtg
    vrvvidvrkdanasvilnnlykqtplqtsfgvnmialvngrpklinlkealvhylehqkt
    vvrrrtqynlrkakdrahileglrialdhideiistiresdtdkvameslqqrfklsekq
    aqaildmrlrrltglerdkieaeynellnyiseletiladeevllqlvrdelteirdrfg
    ddrrteiqlg
    

    Sequence, based on observed residues (ATOM records):
    >6fqvA (A:)
    nernitsemresfldyamsvivaralpdvrdglkpvhrrilyglneqgmtpdksykksar
    ivgdvmgkyhphgdssiyeamvrmaqdfsyryplvdgqgnfgsmdgdgaaamrytearmt
    kitlellrdinkdtidfidnydgnerepsvlparfpnllangasgiavgmatnipphnlt
    elingvlslsknpdisiaelmediegpdfptaglilgksgirrayetgrgsiqmrsravi
    eergggrqrivvteipfqvnkarmiekiaelvrdkkidgitdlrdetslrtgvrvvidvr
    kdanasvilnnlykqtplqtsfgvnmialvngrpklinlkealvhylehqktvvrrrtqy
    nlrkakdrahileglrialdhideiistiresdtdkvameslqqrfklsekqaqaildmr
    lrrltglerdkieaeynellnyiseletiladeevllqlvrdelteirdrfgddrrteiq
    lg
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6fqvB (B:)
    mdvaslpgkladcsskspeeceiflvegdsaggstksgrdsrtqailplrgkilnvekar
    ldrilnnneirqmitafgtgiggdfdlakaryhkivimtdadvdgahirtllltffyrfm
    rplieagyvyiaqpptgykglgemnadqlwettmnpehrallqvkledaieadqtfemlm
    gdvvenrrqfiednavyanldf
    

    Sequence, based on observed residues (ATOM records):
    >6fqvB (B:)
    kladcsskspeeceiflvegdsaggstksgrdsrtqailplrgkilnvekarldrilnnn
    eirqmitafgtgiggdfdlakaryhkivimtdadvdgahirtllltffyrfmrplieagy
    vyiaqpptgykglgemnadqlwettmnpehrallqvkledaieadqtfemlmgdvvenrr
    qfiednav
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >6fqvC (C:)
    aelpqsrinernitsemresfldyamsvivaralpdvrdglkpvhrrilyglneqgmtpd
    ksykksarivgdvmgkyhphgdssiyeamvrmaqdfsyryplvdgqgnfgsmdgdgaaam
    rytearmtkitlellrdinkdtidfidnydgnerepsvlparfpnllangasgiavgmat
    nipphnltelingvlslsknpdisiaelmediegpdfptaglilgksgirrayetgrgsi
    qmrsravieergggrqrivvteipfqvnkarmiekiaelvrdkkidgitdlrdetslrtg
    vrvvidvrkdanasvilnnlykqtplqtsfgvnmialvngrpklinlkealvhylehqkt
    vvrrrtqynlrkakdrahileglrialdhideiistiresdtdkvameslqqrfklsekq
    aqaildmrlrrltglerdkieaeynellnyiseletiladeevllqlvrdelteirdrfg
    ddrrteiqlg
    

    Sequence, based on observed residues (ATOM records):
    >6fqvC (C:)
    nernitsemresfldyamsvivaralpdvrdglkpvhrrilyglneqgmtpdksykksar
    ivgdvmgkyhphgdssiyeamvrmaqdfsyryplvdgqgnfgsmdgdgaaamrytearmt
    kitlellrdinkdtidfidnydgnerepsvlparfpnllangasgiavgmatnipphnlt
    elingvlslsknpdisiaelmediegpdfptaglilgksgirrayetgrgsiqmrsravr
    ivvteipfqvnkarmiekiaelvrdkkidgitdlrdetslrtgvrvvidvrkdanasvil
    nnlykqtplqtsfgvnmialvngrpklinlkealvhylehqktvvrrrtqynlrkakdra
    hileglrialdhideiistiresdtdkvameslqqrfklsekqaqaildmrlrrltgler
    dkieaeynellnyiseletiladeevllqlvrdelteirdrfgddrrteiqlg
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >6fqvD (D:)
    mdvaslpgkladcsskspeeceiflvegdsaggstksgrdsrtqailplrgkilnvekar
    ldrilnnneirqmitafgtgiggdfdlakaryhkivimtdadvdgahirtllltffyrfm
    rplieagyvyiaqpptgykglgemnadqlwettmnpehrallqvkledaieadqtfemlm
    gdvvenrrqfiednavyanldf
    

    Sequence, based on observed residues (ATOM records):
    >6fqvD (D:)
    kladcsskspeeceiflvegdsaggstksgrdsrtqailplrgkilnvekarldrilnnn
    eirqmitafgtgiggdfdlakaryhkivimtdadvdgahirtllltffyrfmrplieagy
    vyiaqpptgykglgemnadqlwettmnpehrallqvkledaieadqtfemlmgdvvenrr
    qfiednavy
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'R':
    Sequence, based on SEQRES records:
    >6fqvR (R:)
    aelpqsrinernitsemresfldyamsvivaralpdvrdglkpvhrrilyglneqgmtpd
    ksykksarivgdvmgkyhphgdssiyeamvrmaqdfsyryplvdgqgnfgsmdgdgaaam
    rytearmtkitlellrdinkdtidfidnydgnerepsvlparfpnllangasgiavgmat
    nipphnltelingvlslsknpdisiaelmediegpdfptaglilgksgirrayetgrgsi
    qmrsravieergggrqrivvteipfqvnkarmiekiaelvrdkkidgitdlrdetslrtg
    vrvvidvrkdanasvilnnlykqtplqtsfgvnmialvngrpklinlkealvhylehqkt
    vvrrrtqynlrkakdrahileglrialdhideiistiresdtdkvameslqqrfklsekq
    aqaildmrlrrltglerdkieaeynellnyiseletiladeevllqlvrdelteirdrfg
    ddrrteiqlg
    

    Sequence, based on observed residues (ATOM records):
    >6fqvR (R:)
    nernitsemresfldyamsvivaralpdvrdglkpvhrrilyglneqgmtpdksykksar
    ivgdvmgkyhphgdssiyeamvrmaqdfsyryplvdgqgnfgsmdgdgaaamrytearmt
    kitlellrdinkdtidfidnydgnerepsvlparfpnllangasgiavgmatnipphnlt
    elingvlslsknpdisiaelmediegpdfptaglilgksgirrayetgrgsiqmrsravi
    eergggrqrivvteipfqvnkarmiekiaelvrdkkidgitdlrdetslrtgvrvvidvr
    kdanasvilnnlykqtplqtsfgvnmialvngrpklinlkealvhylehqktvvrrrtqy
    nlrkakdrahileglrialdhideiistiresdtdkvameslqqrfklsekqaqaildmr
    lrrltglerdkieaeynellnyiseletiladeevllqlvrdelteirdrfgddrrteiq
    lg
    

  • Chain 'S':
    Sequence, based on SEQRES records:
    >6fqvS (S:)
    mdvaslpgkladcsskspeeceiflvegdsaggstksgrdsrtqailplrgkilnvekar
    ldrilnnneirqmitafgtgiggdfdlakaryhkivimtdadvdgahirtllltffyrfm
    rplieagyvyiaqpptgykglgemnadqlwettmnpehrallqvkledaieadqtfemlm
    gdvvenrrqfiednavyanldf
    

    Sequence, based on observed residues (ATOM records):
    >6fqvS (S:)
    kladcsskspeeceiflvegdsaggstksgrdsrtqailplrgkilnvekarldrilnnn
    eirqmitafgtgiggdfdlakaryhkivimtdadvdgahirtllltffyrfmrplieagy
    vyiaqpptgykglgemnadqlwettmnpehrallqvkledaieadqtfemlmgdvvenrr
    qfiednavy
    

  • Chain 'T':
    Sequence, based on SEQRES records:
    >6fqvT (T:)
    aelpqsrinernitsemresfldyamsvivaralpdvrdglkpvhrrilyglneqgmtpd
    ksykksarivgdvmgkyhphgdssiyeamvrmaqdfsyryplvdgqgnfgsmdgdgaaam
    rytearmtkitlellrdinkdtidfidnydgnerepsvlparfpnllangasgiavgmat
    nipphnltelingvlslsknpdisiaelmediegpdfptaglilgksgirrayetgrgsi
    qmrsravieergggrqrivvteipfqvnkarmiekiaelvrdkkidgitdlrdetslrtg
    vrvvidvrkdanasvilnnlykqtplqtsfgvnmialvngrpklinlkealvhylehqkt
    vvrrrtqynlrkakdrahileglrialdhideiistiresdtdkvameslqqrfklsekq
    aqaildmrlrrltglerdkieaeynellnyiseletiladeevllqlvrdelteirdrfg
    ddrrteiqlg
    

    Sequence, based on observed residues (ATOM records):
    >6fqvT (T:)
    nernitsemresfldyamsvivaralpdvrdglkpvhrrilyglneqgmtpdksykksar
    ivgdvmgkyhphgdssiyeamvrmaqdfsyryplvdgqgnfgsmdgdgaaamrytearmt
    kitlellrdinkdtidfidnydgnerepsvlparfpnllangasgiavgmatnipphnlt
    elingvlslsknpdisiaelmediegpdfptaglilgksgirrayetgrgsiqmrsravi
    eergggrqrivvteipfqvnkarmiekiaelvrdkkidgitdlrdetslrtgvrvvidvr
    kdanasvilnnlykqtplqtsfgvnmialvngrpklinlkealvhylehqktvvrrrtqy
    nlrkakdrahileglrialdhideiistiresdtdkvameslqqrfklsekqaqaildmr
    lrrltglerdkieaeynellnyiseletiladeevllqlvrdelteirdrfgddrrteiq
    lg
    

  • Chain 'U':
    Sequence, based on SEQRES records:
    >6fqvU (U:)
    mdvaslpgkladcsskspeeceiflvegdsaggstksgrdsrtqailplrgkilnvekar
    ldrilnnneirqmitafgtgiggdfdlakaryhkivimtdadvdgahirtllltffyrfm
    rplieagyvyiaqpptgykglgemnadqlwettmnpehrallqvkledaieadqtfemlm
    gdvvenrrqfiednavyanldf
    

    Sequence, based on observed residues (ATOM records):
    >6fqvU (U:)
    kladcsskspeeceiflvegdsaggstksgrdsrtqailplrgkilnvekarldrilnnn
    eirqmitafgtgiggdfdlakaryhkivimtdadvdgahirtllltffyrfmrplieagy
    vyiaqpptgykglgemnadqlwettmnpehrallqvkledaieadqtfemlmgdvvenrr
    qfiednavyanl
    

  • Chain 'V':
    No sequence available.

  • Chain 'W':
    No sequence available.