PDB entry 6fqu

View 6fqu on RCSB PDB site
Description: Crystal structure of CREBBP bromodomain complexd with DR09
Class: transferase
Keywords: Inhibitor, Bromodomain, Transferase
Deposited on 2018-02-14, released 2018-08-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-10-10, with a file datestamp of 2018-10-05.
Experiment type: XRAY
Resolution: 1.43 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: creb-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: CREBBP, CBP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6fqua_
  • Heterogens: E3B, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6fquA (A:)
smrkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlsti
krkldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg

    Sequence, based on observed residues (ATOM records): (download) 
    >6fquA (A:)
kkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrk
ldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg