PDB entry 6fqp

View 6fqp on RCSB PDB site
Description: crystal structure of tale homeobox domain transcription factor tgif1 with its consensus dna
Deposited on 2018-02-14, released 2018-07-25
The last revision was dated 2018-10-10, with a file datestamp of 2018-10-05.
Experiment type: XRAY
Resolution: 2.42 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Homeobox protein TGIF1
    Species: Homo sapiens [TaxId:9606]
    Gene: TGIF1, TGIF
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Homeobox protein TGIF1
    Species: Homo sapiens [TaxId:9606]
    Gene: TGIF1, TGIF
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: DNA (5'-d(p*ap*tp*tp*gp*ap*cp*ap*gp*cp*tp*gp*tp*cp*ap*ap*t)-3')
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
  • Chain 'M':
    Compound: DNA (5'-d(p*ap*tp*tp*gp*ap*cp*ap*gp*cp*tp*gp*tp*cp*ap*ap*t)-3')
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
  • Heterogens: CA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6fqpA (A:)
gpmdipldlsssagsgkrrrrgnlpkesvqilrdwlyehrynaypseqekallsqqthls
tlqvcnwfinarrrllpdmlrkdgkdpnqftisrrgakise

    Sequence, based on observed residues (ATOM records):
    >6fqpA (A:)
rgnlpkesvqilrdwlyehrynaypseqekallsqqthlstlqvcnwfinarrrllpdml
rkdgkdp

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6fqpB (B:)
gpmdipldlsssagsgkrrrrgnlpkesvqilrdwlyehrynaypseqekallsqqthls
tlqvcnwfinarrrllpdmlrkdgkdpnqftisrrgakise

    Sequence, based on observed residues (ATOM records):
    >6fqpB (B:)
krrrrgnlpkesvqilrdwlyehrynaypseqekallsqqthlstlqvcnwfinarrrll
pdmlrk

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.