PDB entry 6fqk

View 6fqk on RCSB PDB site
Description: GluA2(flop) S729C ligand binding core dimer bound to ZK200775 at 1.98 Angstrom resolution
Class: membrane protein
Keywords: AMPAR receptor, Ligand binding domain, competitive antagonist, Cross-linked dimer, MEMBRANE PROTEIN
Deposited on 2018-02-14, released 2019-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-13, with a file datestamp of 2019-03-08.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate receptor 2,Glutamate receptor 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gria2, Glur2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19491 (Start-128)
      • linker (129-130)
    • Uniprot P19491 (131-End)
      • conflict (228)
    Domains in SCOPe 2.07: d6fqka_
  • Chain 'B':
    Compound: Glutamate receptor 2,Glutamate receptor 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gria2, Glur2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19491 (Start-128)
      • linker (129-130)
    • Uniprot P19491 (131-End)
      • conflict (228)
    Domains in SCOPe 2.07: d6fqkb_
  • Heterogens: ZK1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fqkA (A:)
    gsamgsgndtsrganktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcg
    fkykltivgdgkygardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfms
    lgisimikkgtpiesaedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaeps
    vfvrttaegvarvrkskgkyayllestmneyieqrkpcdtmkvggnldckgygiatpkgs
    slgnavnlavlklneqglldklknkwwydkgecgsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fqkA (A:)
    ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
    rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies
    aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
    skgkyayllestmneyieqrkpcdtmkvggnldckgygiatpkgsslgnavnlavlklne
    qglldklknkwwydkgecg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6fqkB (B:)
    gsamgsgndtsrganktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcg
    fkykltivgdgkygardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfms
    lgisimikkgtpiesaedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaeps
    vfvrttaegvarvrkskgkyayllestmneyieqrkpcdtmkvggnldckgygiatpkgs
    slgnavnlavlklneqglldklknkwwydkgecgsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fqkB (B:)
    ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
    rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies
    aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
    skgkyayllestmneyieqrkpcdtmkvggnldckgygiatpkgsslgnavnlavlklne
    qglldklknkwwydkgec