PDB entry 6fqe

View 6fqe on RCSB PDB site
Description: Phosphotriesterase PTE_A53_4
Class: hydrolase
Keywords: Metalloenzyme, TIM barrel, hydrolase
Deposited on 2018-02-14, released 2019-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-13, with a file datestamp of 2019-03-08.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Parathion hydrolase
    Species: Brevundimonas diminuta [TaxId:293]
    Gene: OPD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A434
      • conflict (51)
      • conflict (54)
      • conflict (80)
      • conflict (106)
      • conflict (147)
      • conflict (159)
      • conflict (177)
      • conflict (228)
      • conflict (248)
      • conflict (293)
    Domains in SCOPe 2.07: d6fqea_
  • Chain 'B':
    Compound: Parathion hydrolase
    Species: Brevundimonas diminuta [TaxId:293]
    Gene: OPD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A434 (8-339)
      • expression tag (0-7)
      • conflict (51)
      • conflict (54)
      • conflict (80)
      • conflict (106)
      • conflict (147)
      • conflict (159)
      • conflict (177)
      • conflict (228)
      • conflict (248)
      • conflict (293)
    Domains in SCOPe 2.07: d6fqeb1, d6fqeb2
  • Heterogens: D6K, PEG, FMT, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fqeA (A:)
    iseftinsgdrintvrgpitiseagftlthehicgssagflrawpeffgsraalvekavr
    glrraraagvrtivdvstfdagrdvsllaevsraadvhivaatglwedpplsmrlrsvee
    ltqfflreiqygiedtgiragiikvatqgkatpfqelvlraaaraslatgvpvtthtfas
    qrdgeqqaaifeseglspsrvcighsddtddlsyltalaargyligldgiphsaigledn
    asasallgnrswqtrallikalidqgymkqilvsndwlfgfssyvtnimdvmdsvnpdgm
    afiplrvipflrekgvpqetlagitvtnparflsptlras
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fqeA (A:)
    drintvrgpitiseagftlthehicgssagflrawpeffgsraalvekavrglrraraag
    vrtivdvstfdagrdvsllaevsraadvhivaatglwedpplsmrlrsveeltqfflrei
    qygiedtgiragiikvatqgkatpfqelvlraaaraslatgvpvtthtfasqrdgeqqaa
    ifeseglspsrvcighsddtddlsyltalaargyligldgiphsaiglednasasallgn
    rswqtrallikalidqgymkqilvsndwlfgfssyvtnimdvmdsvnpdgmafiplrvip
    flrekgvpqetlagitvtnparflspt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fqeB (B:)
    isefitnsgdrintvrgpitiseagftlthehicgssagflrawpeffgsraalvekavr
    glrraraagvrtivdvstfdagrdvsllaevsraadvhivaatglwedpplsmrlrsvee
    ltqfflreiqygiedtgiragiikvatqgkatpfqelvlraaaraslatgvpvtthtfas
    qrdgeqqaaifeseglspsrvcighsddtddlsyltalaargyligldgiphsaigledn
    asasallgnrswqtrallikalidqgymkqilvsndwlfgfssyvtnimdvmdsvnpdgm
    afiplrvipflrekgvpqetlagitvtnparflsptlras