PDB entry 6fq4

View 6fq4 on RCSB PDB site
Description: structure of chlamydial virulence factor tarp and vinculin head domain
Deposited on 2018-02-13, released 2018-05-09
The last revision was dated 2018-06-13, with a file datestamp of 2018-06-08.
Experiment type: XRAY
Resolution: 2.89 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vinculin
    Species: Gallus gallus [TaxId:9031]
    Gene: VCL, VINC1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: TarP-VBS1
    Species: Chlamydia caviae, synthetic [TaxId:83557]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FQ4
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6fq4A (A:)
    mgsshhhhhhssglvprgshmmpvfhtrtiesilepvaqqishlvimheegevdgkaipd
    ltapvsavqaavsnlvrvgketvqttedqilkrdmppafikvenactklvraaqmlqadp
    ysvpardylidgsrgilsgtsdllltfdeaevrkiirvckgileyltvaevvetmedlvt
    ytknlgpgmtkmakmiderqqelthqehrvmlvnsmntvkellpvlisamkifvttkntk
    sqgieealknrnftvekmsaeineiirvlqltswdedawa
    

    Sequence, based on observed residues (ATOM records):
    >6fq4A (A:)
    mpvfhtrtiesilepvaqqishlvimheegevdgkaipdltapvsavqaavsnlvrvgke
    tvqttedqilkrdmppafikvenactklvraaqmlqadpysvpardylidgsrgilsgts
    dllltfdeaevrkiirvckgileyltvaevvetmedlvtytknlgpgmtkmakmiderqq
    elthqehrvmlvnsmntvkellpvlisamkifvttkntksqgieealknrnftvekmsae
    ineiirvlqlts
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6fq4B (B:)
    lleaarntttmlsktlskvc
    

    Sequence, based on observed residues (ATOM records):
    >6fq4B (B:)
    leaarntttmlsktls