PDB entry 6fpy

View 6fpy on RCSB PDB site
Description: inter-alpha-inhibitor heavy chain 1, wild type
Deposited on 2018-02-12, released 2019-02-27
The last revision was dated 2020-03-18, with a file datestamp of 2020-03-13.
Experiment type: XRAY
Resolution: 2.34 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Inter-alpha-trypsin inhibitor heavy chain H1
    Species: Homo sapiens [TaxId:9606]
    Gene: ITIH1, IGHEP1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Inter-alpha-trypsin inhibitor heavy chain H1
    Species: Homo sapiens [TaxId:9606]
    Gene: ITIH1, IGHEP1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6fpyA (A:)
    mahhhhhhvgtgsndddddkspskssekrqavdtavdgvfirslkvnckvtsrfahyvvt
    sqvvntanearevafdleipktafisdfavtadgnafigdikdkvtawkqyrkaaisgen
    aglvrasgrtmeqftihltvnpqskvtfqltyeevlkrnhmqyeivikvkpkqlvhhfei
    dvdifepqgiskldaqasflpkelaaqtikksfsgkkghvlfrptvsqqqscptcstsll
    nghfkvtydvsrdkicdllvannhfahffapqnltnmnknvvfvidisgsmrgqkvkqtk
    eallkilgdmqpgdyfdlvlfgtrvqswkgslvqaseanlqaaqdfvrgfsldeatnlng
    gllrgieilnqvqeslpelsnhasilimltdgdptegvtdrsqilknvrnairgrfplyn
    lgfghnvdfnflevmsmenngraqriyedhdatqqlqgfysqvakpllvdvdlqypqdav
    laltqnhhkqyyegseivvagriadnkqssfkadvqahgegqefsitclvdeeemkkllr
    erghmlenhverlwayltiqellakrmkvdreeranlssqalqmsldygfvtpltsmsir
    gmadqdglkptidkpsedspplemlgprrtfvlsalqpspthsssntqrlpdrvtgvdtd
    

    Sequence, based on observed residues (ATOM records):
    >6fpyA (A:)
    dtavdgvfirslkvnckvtsrfahyvvtsqvvntanearevafdleipktafisdfavta
    dgnafigdikdkvtawkqyrkaaisgenaglvrasgrtmeqftihltvnpqskvtfqlty
    eevlkrnhmqyeivikvkpkqlvhhfeidvdifepqgiskldaqasflpkelaaqtikks
    fsgkkghvlfrptvsqqqscptcstsllnghfkvtydvsrdkicdllvannhfahffapq
    nltnmnknvvfvidisgsmrgqkvkqtkeallkilgdmqpgdyfdlvlfgtrvqswkgsl
    vqaseanlqaaqdfvrgfsldeatnlnggllrgieilnqvqeslpelsnhasilimltdg
    dptegvtdrsqilknvrnairgrfplynlgfghnvdfnflevmsmenngraqriyedhda
    tqqlqgfysqvakpllvdvdlqypqdavlaltqnhhkqyyegseivvagriadnkqssfk
    advqahgegqefsitclvdeeemkkllrerghmlenhverlwayltiqellakrmkvdre
    eranlssqalqmsldygfvtpltsmsirgmadqdglkptidkpsedprrtfvlsalqpsp
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6fpyB (B:)
    mahhhhhhvgtgsndddddkspskssekrqavdtavdgvfirslkvnckvtsrfahyvvt
    sqvvntanearevafdleipktafisdfavtadgnafigdikdkvtawkqyrkaaisgen
    aglvrasgrtmeqftihltvnpqskvtfqltyeevlkrnhmqyeivikvkpkqlvhhfei
    dvdifepqgiskldaqasflpkelaaqtikksfsgkkghvlfrptvsqqqscptcstsll
    nghfkvtydvsrdkicdllvannhfahffapqnltnmnknvvfvidisgsmrgqkvkqtk
    eallkilgdmqpgdyfdlvlfgtrvqswkgslvqaseanlqaaqdfvrgfsldeatnlng
    gllrgieilnqvqeslpelsnhasilimltdgdptegvtdrsqilknvrnairgrfplyn
    lgfghnvdfnflevmsmenngraqriyedhdatqqlqgfysqvakpllvdvdlqypqdav
    laltqnhhkqyyegseivvagriadnkqssfkadvqahgegqefsitclvdeeemkkllr
    erghmlenhverlwayltiqellakrmkvdreeranlssqalqmsldygfvtpltsmsir
    gmadqdglkptidkpsedspplemlgprrtfvlsalqpspthsssntqrlpdrvtgvdtd
    

    Sequence, based on observed residues (ATOM records):
    >6fpyB (B:)
    dtavdgvfirslkvnckvtsrfahyvvtsqvvntanearevafdleipktafisdfavta
    dgnafigdikdkvtawkqyrkaaisgenaglvrasgrtmeqftihltvnpqskvtfqlty
    eevlkrnhmqyeivikvkpkqlvhhfeidvdifepqgiskldaqasflpkelaaqtikks
    fsgkkghvlfrptvsqqqscptcstsllnghfkvtydvsrdkicdllvannhfahffapq
    nltnmnknvvfvidisgsmrgqkvkqtkeallkilgdmqpgdyfdlvlfgtrvqswkgsl
    vqaseanlqaaqdfvrgfsldeatnlnggllrgieilnqvqeslpelsnhasilimltdg
    dptegvtdrsqilknvrnairgrfplynlgfghnvdfnflevmsmenngraqriyedhda
    tqqlqgfysqvakpllvdvdlqypqdavlaltqnhhkqyyegseivvagriadnkqssfk
    advqahgegqefsitclvdeeemkkllrerghmlenhverlwayltiqellakrmkvdre
    eranlssqalqmsldygfvtpltsmsirgmadqdglkptidkpsedrrtfvlsalqpsp