PDB entry 6fpv

View 6fpv on RCSB PDB site
Description: A llama-derived JBP1-targeting nanobody
Class: immune system
Keywords: nanobody, JBP1, llama, IMMUNE SYSTEM
Deposited on 2018-02-12, released 2018-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-31, with a file datestamp of 2018-10-26.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nanobody
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FPV
    Domains in SCOPe 2.07: d6fpva1, d6fpva2
  • Chain 'B':
    Compound: Nanobody
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FPV
    Domains in SCOPe 2.07: d6fpvb_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fpvA (A:)
    mkyllptaaagllllaaqpamaqvqlvesggglvqaggslrlscaasgsffsindmgwyr
    qapgkqrelvavissggstnyadsvegrstissdnakntvylqlsslkpedtavyycnan
    vrlreyrttsyhywgqgtqvtvsshhhhhhepea
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fpvA (A:)
    qvqlvesggglvqaggslrlscaasgsffsindmgwyrqapgkqrelvavissggstnya
    dsvegrstissdnakntvylqlsslkpedtavyycnanvrlreyrttsyhywgqgtqvtv
    ss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6fpvB (B:)
    mkyllptaaagllllaaqpamaqvqlvesggglvqaggslrlscaasgsffsindmgwyr
    qapgkqrelvavissggstnyadsvegrstissdnakntvylqlsslkpedtavyycnan
    vrlreyrttsyhywgqgtqvtvsshhhhhhepea
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fpvB (B:)
    qvqlvesggglvqaggslrlscaasgsffsindmgwyrqapgkqrelvavissggstnya
    dsvegrstissdnakntvylqlsslkpedtavyycnanvrlreyrttsyhywgqgtqvtv
    s