PDB entry 6fps

View 6fps on RCSB PDB site
Description: Crystal structure of 4-oxalocrotonate tautomerase triple mutant L8Y/M45Y/F50A
Class: isomerase
Keywords: 2-hydroxymuconate tautomerase, isomerase
Deposited on 2018-02-12, released 2019-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-06, with a file datestamp of 2019-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-hydroxymuconate tautomerase
    Species: Pseudomonas putida [TaxId:303]
    Gene: XYLH
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01468 (0-End)
      • engineered mutation (7)
      • engineered mutation (44)
      • engineered mutation (49)
    Domains in SCOPe 2.07: d6fpsa_
  • Chain 'B':
    Compound: 2-hydroxymuconate tautomerase
    Species: Pseudomonas putida [TaxId:303]
    Gene: XYLH
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01468 (0-End)
      • engineered mutation (7)
      • engineered mutation (44)
      • engineered mutation (49)
    Domains in SCOPe 2.07: d6fpsb_
  • Chain 'C':
    Compound: 2-hydroxymuconate tautomerase
    Species: Pseudomonas putida [TaxId:303]
    Gene: XYLH
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01468 (0-End)
      • engineered mutation (7)
      • engineered mutation (44)
      • engineered mutation (49)
    Domains in SCOPe 2.07: d6fpsc_
  • Chain 'D':
    Compound: 2-hydroxymuconate tautomerase
    Species: Pseudomonas putida [TaxId:303]
    Gene: XYLH
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01468 (0-End)
      • engineered mutation (7)
      • engineered mutation (44)
      • engineered mutation (49)
    Domains in SCOPe 2.07: d6fpsd_
  • Chain 'E':
    Compound: 2-hydroxymuconate tautomerase
    Species: Pseudomonas putida [TaxId:303]
    Gene: XYLH
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01468 (0-End)
      • engineered mutation (7)
      • engineered mutation (44)
      • engineered mutation (49)
    Domains in SCOPe 2.07: d6fpse_
  • Chain 'F':
    Compound: 2-hydroxymuconate tautomerase
    Species: Pseudomonas putida [TaxId:303]
    Gene: XYLH
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01468 (0-End)
      • engineered mutation (7)
      • engineered mutation (44)
      • engineered mutation (49)
    Domains in SCOPe 2.07: d6fpsf_
  • Chain 'G':
    Compound: 2-hydroxymuconate tautomerase
    Species: Pseudomonas putida [TaxId:303]
    Gene: XYLH
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01468 (0-End)
      • engineered mutation (7)
      • engineered mutation (44)
      • engineered mutation (49)
    Domains in SCOPe 2.07: d6fpsg_
  • Chain 'H':
    Compound: 2-hydroxymuconate tautomerase
    Species: Pseudomonas putida [TaxId:303]
    Gene: XYLH
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01468 (0-End)
      • engineered mutation (7)
      • engineered mutation (44)
      • engineered mutation (49)
    Domains in SCOPe 2.07: d6fpsh_
  • Chain 'I':
    Compound: 2-hydroxymuconate tautomerase
    Species: Pseudomonas putida [TaxId:303]
    Gene: XYLH
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01468 (0-End)
      • engineered mutation (7)
      • engineered mutation (44)
      • engineered mutation (49)
    Domains in SCOPe 2.07: d6fpsi_
  • Chain 'J':
    Compound: 2-hydroxymuconate tautomerase
    Species: Pseudomonas putida [TaxId:303]
    Gene: XYLH
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01468 (0-End)
      • engineered mutation (7)
      • engineered mutation (44)
      • engineered mutation (49)
    Domains in SCOPe 2.07: d6fpsj_
  • Chain 'K':
    Compound: 2-hydroxymuconate tautomerase
    Species: Pseudomonas putida [TaxId:303]
    Gene: XYLH
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01468 (0-End)
      • engineered mutation (7)
      • engineered mutation (44)
      • engineered mutation (49)
    Domains in SCOPe 2.07: d6fpsk_
  • Chain 'L':
    Compound: 2-hydroxymuconate tautomerase
    Species: Pseudomonas putida [TaxId:303]
    Gene: XYLH
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01468 (0-End)
      • engineered mutation (7)
      • engineered mutation (44)
      • engineered mutation (49)
    Domains in SCOPe 2.07: d6fpsl_
  • Chain 'M':
    Compound: 2-hydroxymuconate tautomerase
    Species: Pseudomonas putida [TaxId:303]
    Gene: XYLH
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01468 (0-End)
      • engineered mutation (7)
      • engineered mutation (44)
      • engineered mutation (49)
    Domains in SCOPe 2.07: d6fpsm_
  • Chain 'N':
    Compound: 2-hydroxymuconate tautomerase
    Species: Pseudomonas putida [TaxId:303]
    Gene: XYLH
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01468 (0-61)
      • engineered mutation (7)
      • engineered mutation (44)
      • engineered mutation (49)
    Domains in SCOPe 2.07: d6fpsn_
  • Chain 'O':
    Compound: 2-hydroxymuconate tautomerase
    Species: Pseudomonas putida [TaxId:303]
    Gene: XYLH
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01468 (0-End)
      • engineered mutation (7)
      • engineered mutation (44)
      • engineered mutation (49)
    Domains in SCOPe 2.07: d6fpso_
  • Chain 'P':
    Compound: 2-hydroxymuconate tautomerase
    Species: Pseudomonas putida [TaxId:303]
    Gene: XYLH
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01468 (0-61)
      • engineered mutation (7)
      • engineered mutation (44)
      • engineered mutation (49)
    Domains in SCOPe 2.07: d6fpsp_
  • Chain 'Q':
    Compound: 2-hydroxymuconate tautomerase
    Species: Pseudomonas putida [TaxId:303]
    Gene: XYLH
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01468 (0-61)
      • engineered mutation (7)
      • engineered mutation (44)
      • engineered mutation (49)
    Domains in SCOPe 2.07: d6fpsq_
  • Chain 'R':
    Compound: 2-hydroxymuconate tautomerase
    Species: Pseudomonas putida [TaxId:303]
    Gene: XYLH
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01468 (0-End)
      • engineered mutation (7)
      • engineered mutation (44)
      • engineered mutation (49)
    Domains in SCOPe 2.07: d6fpsr_
  • Heterogens: PO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fpsA (A:)
    piaqihiyegrsdeqketlirevseaisrsldapltsvrviiteyakghagiggelaskv
    rr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fpsA (A:)
    piaqihiyegrsdeqketlirevseaisrsldapltsvrviiteyakghagiggelask
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6fpsB (B:)
    piaqihiyegrsdeqketlirevseaisrsldapltsvrviiteyakghagiggelaskv
    rr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fpsB (B:)
    piaqihiyegrsdeqketlirevseaisrsldapltsvrviiteyakghagiggelas
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6fpsC (C:)
    piaqihiyegrsdeqketlirevseaisrsldapltsvrviiteyakghagiggelaskv
    rr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fpsC (C:)
    piaqihiyegrsdeqketlirevseaisrsldapltsvrviiteyakghagiggelask
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6fpsD (D:)
    piaqihiyegrsdeqketlirevseaisrsldapltsvrviiteyakghagiggelaskv
    rr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fpsD (D:)
    piaqihiyegrsdeqketlirevseaisrsldapltsvrviiteyakghagiggelask
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6fpsE (E:)
    piaqihiyegrsdeqketlirevseaisrsldapltsvrviiteyakghagiggelaskv
    rr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fpsE (E:)
    piaqihiyegrsdeqketlirevseaisrsldapltsvrviiteyakghagiggelaskv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6fpsF (F:)
    piaqihiyegrsdeqketlirevseaisrsldapltsvrviiteyakghagiggelaskv
    rr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fpsF (F:)
    piaqihiyegrsdeqketlirevseaisrsldapltsvrviiteyakghagiggelas
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6fpsG (G:)
    piaqihiyegrsdeqketlirevseaisrsldapltsvrviiteyakghagiggelaskv
    rr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fpsG (G:)
    piaqihiyegrsdeqketlirevseaisrsldapltsvrviiteyakghagiggelaskv
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6fpsH (H:)
    piaqihiyegrsdeqketlirevseaisrsldapltsvrviiteyakghagiggelaskv
    rr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fpsH (H:)
    piaqihiyegrsdeqketlirevseaisrsldapltsvrviiteyakghagiggelask
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >6fpsI (I:)
    piaqihiyegrsdeqketlirevseaisrsldapltsvrviiteyakghagiggelaskv
    rr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fpsI (I:)
    piaqihiyegrsdeqketlirevseaisrsldapltsvrviiteyakghagiggelask
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >6fpsJ (J:)
    piaqihiyegrsdeqketlirevseaisrsldapltsvrviiteyakghagiggelaskv
    rr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fpsJ (J:)
    piaqihiyegrsdeqketlirevseaisrsldapltsvrviiteyakghagiggelaskv
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >6fpsK (K:)
    piaqihiyegrsdeqketlirevseaisrsldapltsvrviiteyakghagiggelaskv
    rr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fpsK (K:)
    piaqihiyegrsdeqketlirevseaisrsldapltsvrviiteyakghagiggelask
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6fpsL (L:)
    piaqihiyegrsdeqketlirevseaisrsldapltsvrviiteyakghagiggelaskv
    rr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fpsL (L:)
    piaqihiyegrsdeqketlirevseaisrsldapltsvrviiteyakghagiggelas
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >6fpsM (M:)
    piaqihiyegrsdeqketlirevseaisrsldapltsvrviiteyakghagiggelaskv
    rr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fpsM (M:)
    piaqihiyegrsdeqketlirevseaisrsldapltsvrviiteyakghagiggelask
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fpsN (N:)
    piaqihiyegrsdeqketlirevseaisrsldapltsvrviiteyakghagiggelaskv
    rr
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >6fpsO (O:)
    piaqihiyegrsdeqketlirevseaisrsldapltsvrviiteyakghagiggelaskv
    rr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fpsO (O:)
    piaqihiyegrsdeqketlirevseaisrsldapltsvrviiteyakghagiggelas
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fpsP (P:)
    piaqihiyegrsdeqketlirevseaisrsldapltsvrviiteyakghagiggelaskv
    rr
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fpsQ (Q:)
    piaqihiyegrsdeqketlirevseaisrsldapltsvrviiteyakghagiggelaskv
    rr
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >6fpsR (R:)
    piaqihiyegrsdeqketlirevseaisrsldapltsvrviiteyakghagiggelaskv
    rr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fpsR (R:)
    piaqihiyegrsdeqketlirevseaisrsldapltsvrviiteyakghagiggelas