PDB entry 6fpk

View 6fpk on RCSB PDB site
Description: co-translational folding intermediate dictates membrane targeting of the signal recognition particle (srp)- receptor
Deposited on 2018-02-11, released 2018-05-09
The last revision was dated 2018-06-06, with a file datestamp of 2018-06-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: signal recognition particle receptor ftsy
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: ftsY, b3464, JW3429
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MPD, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6fpkA (A:)
    gskkidddlfeeleeqlliadvgvettrkiitnltegasrkqlrdaealygllkeemgei
    la
    

    Sequence, based on observed residues (ATOM records):
    >6fpkA (A:)
    ddlfeeleeqlliadvgvettrkiitnltegasrkqlrdaealygllkeemge