PDB entry 6fpj

View 6fpj on RCSB PDB site
Description: Structure of the AMPAR GluA3 N-terminal domain bound to phosphate
Class: membrane protein
Keywords: ligand-gated ion channel, membrane protein, AMPA receptor
Deposited on 2018-02-09, released 2018-12-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-19, with a file datestamp of 2018-12-14.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate receptor 3
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gria3, Glur3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fpja_
  • Chain 'B':
    Compound: Glutamate receptor 3
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gria3, Glur3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fpjb_
  • Chain 'C':
    Compound: Glutamate receptor 3
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gria3, Glur3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fpjc_
  • Heterogens: NAG, PO4, DMS, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fpjA (A:)
    gfpntisigglfmrntvqehsafrfavqlyntnqnttekpfhlnyhvdhldssnsfsvtn
    afcsqfsrgvyaifgfydqmsmntltsfcgalhtsfvtpsfptdadvqfviqmrpalkga
    ilsllsyykwekfvylydtergfsvlqaimeaavqnnwqvtarsvgnikdvqefrriiee
    mdrrqekrylidceverintileqvvilgkhsrgyhymlanlgftdillervmhgganit
    gfqivnnenpmvqqfiqrwvrlderefpeaknaplkytsalthdailviaeafrylrrqr
    vdvsrrgsagdclanpavpwsqgidieralkmvqvqgmtgniqfdtygrrtnytidvyem
    kvsgsrkagywneyerfvpfsgtkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fpjA (A:)
    gfpntisigglfmrntvqehsafrfavqlyntnqnttekpfhlnyhvdhldssnsfsvtn
    afcsqfsrgvyaifgfydqmsmntltsfcgalhtsfvtpsfptdadvqfviqmrpalkga
    ilsllsyykwekfvylydtergfsvlqaimeaavqnnwqvtarsvgnikdvqefrriiee
    mdrrqekrylidceverintileqvvilgkhsrgyhymlanlgftdillervmhgganit
    gfqivnnenpmvqqfiqrwvrlderefpeaknaplkytsalthdailviaeafrylrrqr
    vdvsrrclaavpwsqgidieralkmvqvqgmtgniqfdtygrrtnytidvyemkvsgsrk
    agywneyerfvpfs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6fpjB (B:)
    gfpntisigglfmrntvqehsafrfavqlyntnqnttekpfhlnyhvdhldssnsfsvtn
    afcsqfsrgvyaifgfydqmsmntltsfcgalhtsfvtpsfptdadvqfviqmrpalkga
    ilsllsyykwekfvylydtergfsvlqaimeaavqnnwqvtarsvgnikdvqefrriiee
    mdrrqekrylidceverintileqvvilgkhsrgyhymlanlgftdillervmhgganit
    gfqivnnenpmvqqfiqrwvrlderefpeaknaplkytsalthdailviaeafrylrrqr
    vdvsrrgsagdclanpavpwsqgidieralkmvqvqgmtgniqfdtygrrtnytidvyem
    kvsgsrkagywneyerfvpfsgtkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fpjB (B:)
    fpntisigglfmrntvqehsafrfavqlyntnqnttekpfhlnyhvdhldssnsfsvtna
    fcsqfsrgvyaifgfydqmsmntltsfcgalhtsfvtpsfptdadvqfviqmrpalkgai
    lsllsyykwekfvylydtergfsvlqaimeaavqnnwqvtarsvgnikdvqefrriieem
    drrqekrylidceverintileqvvilgkhsrgyhymlanlgftdillervmhgganitg
    fqivnnenpmvqqfiqrwvrlderefpeaknaplkytsalthdailviaeafrylrrqrv
    dvsrrgsagdclanpavpwsqgidieralkmvqvqgmtgniqfdtygrrtnytidvyemk
    vsgsrkagywneyerfvpf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6fpjC (C:)
    gfpntisigglfmrntvqehsafrfavqlyntnqnttekpfhlnyhvdhldssnsfsvtn
    afcsqfsrgvyaifgfydqmsmntltsfcgalhtsfvtpsfptdadvqfviqmrpalkga
    ilsllsyykwekfvylydtergfsvlqaimeaavqnnwqvtarsvgnikdvqefrriiee
    mdrrqekrylidceverintileqvvilgkhsrgyhymlanlgftdillervmhgganit
    gfqivnnenpmvqqfiqrwvrlderefpeaknaplkytsalthdailviaeafrylrrqr
    vdvsrrgsagdclanpavpwsqgidieralkmvqvqgmtgniqfdtygrrtnytidvyem
    kvsgsrkagywneyerfvpfsgtkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fpjC (C:)
    fpntisigglfmrntvqehsafrfavqlyntnqnttekpfhlnyhvdhldssnsfsvtna
    fcsqfsrgvyaifgfydqmsmntltsfcgalhtsfvtpsfptdadvqfviqmrpalkgai
    lsllsyykwekfvylydtergfsvlqaimeaavqnnwqvtarsvgnikdvqefrriieem
    drrqekrylidceverintileqvvilgkhsrgyhymlanlgftdillervmhgganitg
    fqivnnenpmvqqfiqrwvrlderefpeaknaplkytsalthdailviaeafrylrrqrv
    dvsrdclawsqgidieralkmvqvqgmtgniqfdtygrrtnytidvyemsrkagywneye
    rfvpf