PDB entry 6fpi

View 6fpi on RCSB PDB site
Description: Structure of fully reduced Hydrogenase (Hyd-1) variant E28Q
Class: oxidoreductase
Keywords: NiFe hydrogenase, Iron sulphur cluster, periplasm, hydrogen, OXIDOREDUCTASE
Deposited on 2018-02-09, released 2018-12-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'L':
    Compound: Hydrogenase-1 large chain
    Species: Escherichia coli K-12 [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACD8 (Start-581)
      • conflict (27)
    Domains in SCOPe 2.08: d6fpil_
  • Chain 'M':
    Compound: Hydrogenase-1 large chain
    Species: Escherichia coli K-12 [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACD8 (Start-581)
      • conflict (27)
    Domains in SCOPe 2.08: d6fpim_
  • Chain 'S':
    Compound: Hydrogenase-1 small chain
    Species: Escherichia coli K-12 [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6fpis_
  • Chain 'T':
    Compound: Hydrogenase-1 small chain
    Species: Escherichia coli K-12 [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6fpit_
  • Heterogens: SF4, F3S, SF3, LMT, CL, EJ2, MG, SO4, HOH

PDB Chain Sequences:

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6fpiL (L:)
    mstqyetqgytinnagrrlvvdpitriqghmrcevnindqnvitnavscgtmfrgleiil
    qgrdprdawafvericgvctgvhalasvyaiedaigikvpdnaniirnimlatlwchdhl
    vhfyqlagmdwidvldalkadprktselaqslsswpksspgyffdvqnrlkkfveggqlg
    ifrngywghpqyklppeanlmgfahylealdfqreivkihavfggknphpnwivggmpca
    inidesgavgavnmerlnlvqsiitrtadfinnvmipdalaigqfnkpwseigtglsdkc
    vlsygafpdiandfgeksllmpggavingdfnnvlpvdlvdpqqvqefvdhawyrypndq
    vgrhpfdgitdpwynpgdvkgsdtniqqlneqeryswikaprwrgnamevgplartliay
    hkgdaatvesvdrmmsalnlplsgiqstlgrilcraheaqwaagklqyffdklmtnlkng
    nlatastekwepatwptecrgvgfteaprgalghwaairdgkidlyqcvvpttwnasprd
    pkgqigayeaalmntkmaipeqpleilrtlhsfdpclacsth
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fpiL (L:)
    stqyetqgytinnagrrlvvdpitriqghmrcevnindqnvitnavscgtmfrgleiilq
    grdprdawafvericgvctgvhalasvyaiedaigikvpdnaniirnimlatlwchdhlv
    hfyqlagmdwidvldalkadprktselaqslsswpksspgyffdvqnrlkkfveggqlgi
    frngywghpqyklppeanlmgfahylealdfqreivkihavfggknphpnwivggmpcai
    nidesgavgavnmerlnlvqsiitrtadfinnvmipdalaigqfnkpwseigtglsdkcv
    lsygafpdiandfgeksllmpggavingdfnnvlpvdlvdpqqvqefvdhawyrypndqv
    grhpfdgitdpwynpgdvkgsdtniqqlneqeryswikaprwrgnamevgplartliayh
    kgdaatvesvdrmmsalnlplsgiqstlgrilcraheaqwaagklqyffdklmtnlkngn
    latastekwepatwptecrgvgfteaprgalghwaairdgkidlyqcvvpttwnasprdp
    kgqigayeaalmntkmaipeqpleilrtlhsfdpclacsth
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >6fpiM (M:)
    mstqyetqgytinnagrrlvvdpitriqghmrcevnindqnvitnavscgtmfrgleiil
    qgrdprdawafvericgvctgvhalasvyaiedaigikvpdnaniirnimlatlwchdhl
    vhfyqlagmdwidvldalkadprktselaqslsswpksspgyffdvqnrlkkfveggqlg
    ifrngywghpqyklppeanlmgfahylealdfqreivkihavfggknphpnwivggmpca
    inidesgavgavnmerlnlvqsiitrtadfinnvmipdalaigqfnkpwseigtglsdkc
    vlsygafpdiandfgeksllmpggavingdfnnvlpvdlvdpqqvqefvdhawyrypndq
    vgrhpfdgitdpwynpgdvkgsdtniqqlneqeryswikaprwrgnamevgplartliay
    hkgdaatvesvdrmmsalnlplsgiqstlgrilcraheaqwaagklqyffdklmtnlkng
    nlatastekwepatwptecrgvgfteaprgalghwaairdgkidlyqcvvpttwnasprd
    pkgqigayeaalmntkmaipeqpleilrtlhsfdpclacsth
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fpiM (M:)
    stqyetqgytinnagrrlvvdpitriqghmrcevnindqnvitnavscgtmfrgleiilq
    grdprdawafvericgvctgvhalasvyaiedaigikvpdnaniirnimlatlwchdhlv
    hfyqlagmdwidvldalkadprktselaqslsswpksspgyffdvqnrlkkfveggqlgi
    frngywghpqyklppeanlmgfahylealdfqreivkihavfggknphpnwivggmpcai
    nidesgavgavnmerlnlvqsiitrtadfinnvmipdalaigqfnkpwseigtglsdkcv
    lsygafpdiandfgeksllmpggavingdfnnvlpvdlvdpqqvqefvdhawyrypndqv
    grhpfdgitdpwynpgdvkgsdtniqqlneqeryswikaprwrgnamevgplartliayh
    kgdaatvesvdrmmsalnlplsgiqstlgrilcraheaqwaagklqyffdklmtnlkngn
    latastekwepatwptecrgvgfteaprgalghwaairdgkidlyqcvvpttwnasprdp
    kgqigayeaalmntkmaipeqpleilrtlhsfdpclacsth
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >6fpiS (S:)
    lenkpripvvwihglectcctesfirsahplakdvilslisldyddtlmaaagtqaeevf
    ediitqyngkyilavegnpplgeqgmfcissgrpfieklkraaagasaiiawgtcaswgc
    vqaarpnptqatpidkvitdkpiikvpgcppipdvmsaiitymvtfdrlpdvdrmgrplm
    fygqrihdkcyrrahfdagefvqswdddaarkgyclykmgckgpttynacsstrwndgvs
    fpiqsghgclgcaengfwdrgsfysrvvdipqmgthstadtvgltalgvvaaavgvhava
    savdqrrrhnqqptetehqpgnedkqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fpiS (S:)
    kpripvvwihglectcctesfirsahplakdvilslisldyddtlmaaagtqaeevfedi
    itqyngkyilavegnpplgeqgmfcissgrpfieklkraaagasaiiawgtcaswgcvqa
    arpnptqatpidkvitdkpiikvpgcppipdvmsaiitymvtfdrlpdvdrmgrplmfyg
    qrihdkcyrrahfdagefvqswdddaarkgyclykmgckgpttynacsstrwndgvsfpi
    qsghgclgcaengfwdrgsfysrvvdip
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >6fpiT (T:)
    lenkpripvvwihglectcctesfirsahplakdvilslisldyddtlmaaagtqaeevf
    ediitqyngkyilavegnpplgeqgmfcissgrpfieklkraaagasaiiawgtcaswgc
    vqaarpnptqatpidkvitdkpiikvpgcppipdvmsaiitymvtfdrlpdvdrmgrplm
    fygqrihdkcyrrahfdagefvqswdddaarkgyclykmgckgpttynacsstrwndgvs
    fpiqsghgclgcaengfwdrgsfysrvvdipqmgthstadtvgltalgvvaaavgvhava
    savdqrrrhnqqptetehqpgnedkqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fpiT (T:)
    kpripvvwihglectcctesfirsahplakdvilslisldyddtlmaaagtqaeevfedi
    itqyngkyilavegnpplgeqgmfcissgrpfieklkraaagasaiiawgtcaswgcvqa
    arpnptqatpidkvitdkpiikvpgcppipdvmsaiitymvtfdrlpdvdrmgrplmfyg
    qrihdkcyrrahfdagefvqswdddaarkgyclykmgckgpttynacsstrwndgvsfpi
    qsghgclgcaengfwdrgsfysrvvdip