PDB entry 6fpe

View 6fpe on RCSB PDB site
Description: Bacterial protein complex
Class: RNA binding protein
Keywords: Complex, RNA BINDING PROTEIN
Deposited on 2018-02-09, released 2018-05-23
Made obsolete by 6s84 on 2019-07-17

The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-23, with a file datestamp of 2018-05-18.
Experiment type: XRAY
Resolution: 3.14 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tRNA threonylcarbamoyladenosine biosynthesis protein tsab
    Species: Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) [TaxId:243274]
    Gene: tsaB, TM_0874, Tmari_0876
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fpea1, d6fpea2
  • Chain 'B':
    Compound: tRNA N6-adenosine threonylcarbamoyltransferase
    Species: Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) [TaxId:243274]
    Gene: tsaD, gcp, TM_0145
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: tRNA threonylcarbamoyladenosine biosynthesis protein tsab
    Species: Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) [TaxId:243274]
    Gene: tsaB, TM_0874, Tmari_0876
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fpec1, d6fpec2
  • Chain 'D':
    Compound: ATPase YjeE, predicted to have essential role in cell wall biosynthesis
    Species: Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) [TaxId:243274]
    Gene: Tmari_1641
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: ATPase YjeE, predicted to have essential role in cell wall biosynthesis
    Species: Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) [TaxId:243274]
    Gene: Tmari_1641
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: tRNA N6-adenosine threonylcarbamoyltransferase
    Species: Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) [TaxId:243274]
    Gene: tsaD, gcp, TM_0145
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, PEG, MG, APC

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fpeA (A:)
    mnvlaldtsqririglrkgedlfeisytgekkhaeilpvvvkklldeldlkvkdldvvgv
    gigpggltglrvgiatvvglvspydipvaplnsfemtakscpadgvvlvarrarkgyhyc
    avylkdkglnplkepsvvsdeeleeitkefspkivlkddllispavlveeserlfrekkt
    ihyyeieplylqksiaelnwekkkrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fpeA (A:)
    mnvlaldtsqririglrkgedlfeisytgekkhaeilpvvvkklldeldlkvkdldvvgv
    gigpggltglrvgiatvvglvspydipvaplnsfemtakscpadgvvlvarrarkgyhyc
    avylkdkglnplkepsvvsdeeleeitkefspkivlkddllispavlveeserlfrekkt
    ihyyeieplylqk
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6fpeC (C:)
    mnvlaldtsqririglrkgedlfeisytgekkhaeilpvvvkklldeldlkvkdldvvgv
    gigpggltglrvgiatvvglvspydipvaplnsfemtakscpadgvvlvarrarkgyhyc
    avylkdkglnplkepsvvsdeeleeitkefspkivlkddllispavlveeserlfrekkt
    ihyyeieplylqksiaelnwekkkrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fpeC (C:)
    mnvlaldtsqririglrkgedlfeisytgekkhaeilpvvvkklldeldlkvkdldvvgv
    gigpggltglrvgiatvvglvspydipvaplnsfemtakscpadgvvlvarrarkgyhyc
    avylkdkglnplkepsvvsdeeleeitkefspkivlkddllispavlveeserlfrekkt
    ihyyeieplylqksiaelnwekkkr
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'G':
    No sequence available.