PDB entry 6foz

View 6foz on RCSB PDB site
Description: the crystal structure of p.fluorescens kynurenine 3-monooxygenase (kmo) in complex with competitive inhibitor no. 13
Deposited on 2018-02-08, released 2019-08-21
The last revision was dated 2020-03-04, with a file datestamp of 2020-02-28.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kynurenine 3-monooxygenase
    Species: Pseudomonas fluorescens [TaxId:294]
    Gene: kmo, qbsG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84HF5
      • conflict (250)
  • Chain 'B':
    Compound: Kynurenine 3-monooxygenase
    Species: Pseudomonas fluorescens [TaxId:294]
    Gene: kmo, qbsG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84HF5
      • conflict (250)
  • Heterogens: E0H, FAD, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6fozA (A:)
    tatdnarqvtiigaglagtlvarllarngwqvnlferrpdprietgargrsinlalaerg
    ahalrlaglerevlaeavmmrgrmvhvpgtppnlqpygrddseviwsinrdrlnrilldg
    aeaagasihfnlgldsvdfarqrltlsnvsgerlekrfhlligadgcnsavrqamasvvd
    lgehletqphgykelqitpeasaqfnlepnalhiwphgdymcialpnldrsftvtlflhh
    qspaaqpaspsfaqlvdghaarrffqrqfpdlspmldsleqdfehhptgklatlrlttwh
    vggqavllgdaahpmvpfhgqgmncaledavalaehlqsaadnasalaaftaqrqpdala
    iqamalenyvemsskvasptyllerelgqimaqrqptrfiprysmvtfsrlpyaqamarg
    qiqeqllkfavanhsdltsinldavehevtrclpplshls
    

    Sequence, based on observed residues (ATOM records):
    >6fozA (A:)
    arqvtiigaglagtlvarllarngwqvnlferrpdprietgargrsinlalaergahalr
    laglerevlaeavmmrgrmvhvpgtppnlqpygrddseviwsinrdrlnrilldgaeaag
    asihfnlgldsvdfarqrltlsnvsgerlekrfhlligadgcnsavrqamasvvdlgehl
    etqphgykelqitpeasaqfnlepnalhiwphgdymcialpnldrsftvtlflhhqspap
    aspsfaqlvdghaarrffqrqfpdlspmldsleqdfehhptgklatlrlttwhvggqavl
    lgdaahpmvpfhgqgmncaledavalaehlqsaadnasalaaftaqrqpdalaiqamale
    nyvemsyllerelgqimaqrqptrfiprysmvtfsrlpyaqamargqiqeqllkfavanh
    sdltsinldavehevtrclpp
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6fozB (B:)
    tatdnarqvtiigaglagtlvarllarngwqvnlferrpdprietgargrsinlalaerg
    ahalrlaglerevlaeavmmrgrmvhvpgtppnlqpygrddseviwsinrdrlnrilldg
    aeaagasihfnlgldsvdfarqrltlsnvsgerlekrfhlligadgcnsavrqamasvvd
    lgehletqphgykelqitpeasaqfnlepnalhiwphgdymcialpnldrsftvtlflhh
    qspaaqpaspsfaqlvdghaarrffqrqfpdlspmldsleqdfehhptgklatlrlttwh
    vggqavllgdaahpmvpfhgqgmncaledavalaehlqsaadnasalaaftaqrqpdala
    iqamalenyvemsskvasptyllerelgqimaqrqptrfiprysmvtfsrlpyaqamarg
    qiqeqllkfavanhsdltsinldavehevtrclpplshls
    

    Sequence, based on observed residues (ATOM records):
    >6fozB (B:)
    arqvtiigaglagtlvarllarngwqvnlferrpdprietgargrsinlalaergahalr
    laglerevlaeavmmrgrmvhvpgtppnlqpyddseviwsinrdrlnrilldgaeaagas
    ihfnlgldsvdfarqrltlsnvsgerlekrfhlligadgcnsavrqamasvvdlgehlet
    qphgykelqitpeasaqfnlepnalhiwphgdymcialpnldrsftvtlflhhqspasps
    faqlvdghaarrffqrqfpdlspmldsleqdfehhptgklatlrlttwhvggqavllgda
    ahpmvpfhgqgmncaledavalaehlqsaadnasalaaftaqrqpdalaiqamalenyve
    msptyllerelgqimaqrqptrfiprysmvtfsrlpyaqamargqiqeqllkfavanhsd
    ltsinldavehevtrc