PDB entry 6fou

View 6fou on RCSB PDB site
Description: crystal structure of torpedo californica acetylcholinesterase in complex with 12-amino-3-chloro-6,7,10,11-tetrahydro-5,9-dimethyl-7, 11-methanocycloocta[b]quinolin-5-ium
Deposited on 2018-02-08, released 2018-03-28
Made obsolete by 6g1v on 2018-04-04

The last revision was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylcholinesterase
    Species: Tetronarce californica [TaxId:7787]
    Gene: ACHE
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: acetylcholinesterase
    Species: Tetronarce californica [TaxId:7787]
    Gene: ACHE
    Database cross-references and differences (RAF-indexed):
  • Heterogens: E1N, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6fouA (A:)
    mnllvtsslgvllhlvvlcqaddhsellvntksgkvmgtrvpvlsshisaflgipfaepp
    vgnmrfrrpepkkpwsgvwnastypnncqqyvdeqfpgfsgsemwnpnremsedclylni
    wvpsprpksttvmvwiygggfysgsstldvyngkylayteevvlvslsyrvgafgflalh
    gsqeapgnvglldqrmalqwvhdniqffggdpktvtifgesaggasvgmhilspgsrdlf
    rrailqsgspncpwasvsvaegrrravelgrnlncnlnsdeelihclrekkpqelidvew
    nvlpfdsifrfsfvpvidgeffptslesmlnsgnfkktqillgvnkdegsffllygapgf
    skdseskisredfmsgvklsvphandlgldavtlqytdwmddnngiknrdglddivgdhn
    vicplmhfvnkytkfgngtylyffnhrasnlvwpewmgvihgyeiefvfglplvkelnyt
    aeeealsrrimhywatfaktgnpnephsqeskwplfttkeqkfidlntepmkvhqrlrvq
    mcvfwnqflpkllnatacdgelsssgtssskgiifyvlfsilylif
    

    Sequence, based on observed residues (ATOM records):
    >6fouA (A:)
    sellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwnasty
    pnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiygggfysg
    sstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwvhdn
    iqffggdpktvtifgesaggasvgmhilspgsrdlfrrailqsgspncpwasvsvaegrr
    ravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgeffpt
    slesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvklsvpha
    ndlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngtylyff
    nhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfaktgnpn
    ephsqeskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllnat
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6fouB (B:)
    mnllvtsslgvllhlvvlcqaddhsellvntksgkvmgtrvpvlsshisaflgipfaepp
    vgnmrfrrpepkkpwsgvwnastypnncqqyvdeqfpgfsgsemwnpnremsedclylni
    wvpsprpksttvmvwiygggfysgsstldvyngkylayteevvlvslsyrvgafgflalh
    gsqeapgnvglldqrmalqwvhdniqffggdpktvtifgesaggasvgmhilspgsrdlf
    rrailqsgspncpwasvsvaegrrravelgrnlncnlnsdeelihclrekkpqelidvew
    nvlpfdsifrfsfvpvidgeffptslesmlnsgnfkktqillgvnkdegsffllygapgf
    skdseskisredfmsgvklsvphandlgldavtlqytdwmddnngiknrdglddivgdhn
    vicplmhfvnkytkfgngtylyffnhrasnlvwpewmgvihgyeiefvfglplvkelnyt
    aeeealsrrimhywatfaktgnpnephsqeskwplfttkeqkfidlntepmkvhqrlrvq
    mcvfwnqflpkllnatacdgelsssgtssskgiifyvlfsilylif
    

    Sequence, based on observed residues (ATOM records):
    >6fouB (B:)
    sellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwnasty
    pnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiygggfysg
    sstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwvhdn
    iqffggdpktvtifgesaggasvgmhilspgsrdlfrrailqsgspncpwasvsvaegrr
    ravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgeffpt
    slesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvklsvpha
    ndlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngtylyff
    nhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfaktgnpn
    ephsqeskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllnat