PDB entry 6for

View 6for on RCSB PDB site
Description: Phosphotriesterase PTE_A53_6
Class: hydrolase
Keywords: Metalloenzyme, TIM barrel, hydrolase
Deposited on 2018-02-08, released 2019-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-13, with a file datestamp of 2019-03-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Parathion hydrolase
    Species: Brevundimonas diminuta [TaxId:293]
    Gene: OPD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A434
      • conflict (50)
      • conflict (53)
      • conflict (79)
      • conflict (105)
      • conflict (146)
      • conflict (158)
      • conflict (176)
      • conflict (227)
      • conflict (247)
      • conflict (292)
    Domains in SCOPe 2.07: d6fora_
  • Heterogens: FMT, ZN, SO4, GB, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6forA (A:)
    iseftnsgdrintvrgpitiseagftlthehicgssagflrawpeffgsraalvekavrg
    lrraraagvrtivdvstfdagrdvsllaevsraadvhivaatglwedpplsmrlrsveel
    tqfflreiqygiedtgiragiikvatqgkatpfqelvlraaaraslatgvpvtthtfasq
    rdgeqqaaifeseglspsrvcighsddtddlsyltalaargyligldgiphsaigledna
    sasallgnrswqtrallikalidqgymkqilvsndwlfgfssyvtnimdvmdsvnpdgma
    fiplrvipflrekgvpqetlagitvtnparflsptlras
    

    Sequence, based on observed residues (ATOM records): (download)
    >6forA (A:)
    drintvrgpitiseagftlthehicgssagflrawpeffgsraalvekavrglrraraag
    vrtivdvstfdagrdvsllaevsraadvhivaatglwedpplsmrlrsveeltqfflrei
    qygiedtgiragiikvatqgkatpfqelvlraaaraslatgvpvtthtfasqrdgeqqaa
    ifeseglspsrvcighsddtddlsyltalaargyligldgiphsaiglednasasallgn
    rswqtrallikalidqgymkqilvsndwlfgfssyvtnimdvmdsvnpdgmafiplrvip
    flrekgvpqetlagitvtnparflsptl