PDB entry 6fo4

View 6fo4 on RCSB PDB site
Description: The cryofrozen atomic resolution neutron crystal structure of the reduced form perdeuterated Pyrococcus furiosus Rubredoxin (100K, 0.94A resolution) shows Hydroniums and Zundel cations networks.
Class: electron transport
Keywords: Perdeuterated, rubredoxin, pyrococcus furiosus, atomic resolution, Cryostream frozen crystal, Zundel cation, [H5O2]+, Hydronium, D3O, Eigen cation, ELECTRON TRANSPORT., ELECTRON TRANSPORT
Deposited on 2018-02-06, released 2019-03-13
Made obsolete on 2019-03-20

The last revision prior to the SCOPe 2.08 freeze date was dated 2021-06-23, with a file datestamp of 2021-06-18.
Experiment type: NEUT
Resolution: 0.94 Å
R-factor: N/A
AEROSPACI score: 0.98 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubredoxin
    Species: Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) [TaxId:186497]
    Gene: RUB, PF1282
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6fo4a_
  • Heterogens: FE, D3O, D8U, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fo4A (A:)
    makwvckicgyiydedagdpdngispgtkfeelpddwvcpicgapksefekled