PDB entry 6fnv

View 6fnv on RCSB PDB site
Description: solution structure of mule deer prion protein with polymorphism s138
Deposited on 2018-02-05, released 2019-08-28
The last revision was dated 2019-08-28, with a file datestamp of 2019-08-23.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major prion protein
    Species: Odocoileus hemionus [TaxId:9872]
    Gene: PRNP
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6fnvA (A:)
gqggthsqwnkpskpktnmkhvagaaaagavvgglggymlgsamsrplihfgndyedryy
renmyrypnqvyyrpvdqynnqntfvhdcvnitvkqhtvttttkgenftetdikmmervv
eqmcitqyqresqayyqrga