PDB entry 6fnu

View 6fnu on RCSB PDB site
Description: Structure of S. cerevisiae Methylenetetrahydrofolate reductase 1, catalytic domain
Class: oxidoreductase
Keywords: reductase, one carbon metabolism, TIM barrel, folate metabolism, Structural Genomics, Structural Genomics Consortium, SGC, oxidoreductase
Deposited on 2018-02-05, released 2018-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 1.56 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methylenetetrahydrofolate reductase 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: MET12, YPL023C, LPB8C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46151 (6-End)
      • expression tag (0-5)
    Domains in SCOPe 2.07: d6fnua1, d6fnua2
  • Heterogens: FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fnuA (A:)
    nlyfqsmsirdlyharaspfisleffppktelgtrnlmermhrmtaldplfitvtwgagg
    ttaektltlaslaqqtlnipvcmhltctntekaiiddaldrcynagirnilalrgdppig
    edwldsqsnespfkyavdlvryikqsygdkfcvgvaaypeghcegeaegheqdplkdlvy
    lkekveagadfvitqlfydvekfltfemlfrerisqdlplfpglmpinsyllfhraakls
    hasippailsrfppeiqsddnavksigvdilieliqeiyqrtsgrikgfhfytlnlekai
    aqivsqsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fnuA (A:)
    nlyfqsmsirdlyharaspfisleffppktelgtrnlmermhrmtaldplfitvtwgagg
    ttaektltlaslaqqtlnipvcmhltctntekaiiddaldrcynagirnilalrgdppig
    edwldspfkyavdlvryikqsygdkfcvgvaaypeghcegqdplkdlvylkekveagadf
    vitqlfydvekfltfemlfrerisqdlplfpglmpinsyllfhraaklshasippailsr
    fppeiqsddnavksigvdilieliqeiyqrtsgrikgfhfytlnlekaiaqivsqs