PDB entry 6fnl

View 6fnl on RCSB PDB site
Description: Crystal Structure of Ephrin B4 (EphB4) Receptor Protein Kinase
Class: transferase
Keywords: Protein Tyrosine Kinase, Transferase
Deposited on 2018-02-04, released 2018-08-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-08, with a file datestamp of 2018-08-03.
Experiment type: XRAY
Resolution: 1.27 Å
R-factor: N/A
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ephrin type-B receptor 4
    Species: Homo sapiens [TaxId:9606]
    Gene: EPHB4, HTK, MYK1, TYRO11
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54760
      • engineered mutation (207)
      • engineered mutation (274)
    Domains in SCOPe 2.07: d6fnla_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fnlA (A:)
    gmdpneavrefakeidvsyvkieevigagefgevcrgrlkapgkkescvaiktlkggyte
    rqrreflseasimgqfehpniirlegvvtnsmpvmiltefmengaldsflrlndgqftvi
    qlvgmlrgiasgmrylaemsyvhrdlaarnilvnsnlvckvsdfglsrfleenssdptet
    sslggkipirwtapeaiafrkftsasdvwsygivmwevmsfgerpywdmsnqdvinaieq
    dyrlppppdcptslhqlmldcwqkdrnarprfpqivsaldkmirnpaslkivareng
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fnlA (A:)
    akeidvsyvkieevigagefgevcrgrlkapgkkescvaiktlkggyterqrreflseas
    imgqfehpniirlegvvtnsmpvmiltefmengaldsflrlndgqftviqlvgmlrgias
    gmrylaemsyvhrdlaarnilvnsnlvckvsdfgkipirwtapeaiafrkftsasdvwsy
    givmwevmsfgerpywdmsnqdvinaieqdyrlppppdcptslhqlmldcwqkdrnarpr
    fpqivsaldkmirnpaslkiva