PDB entry 6fnh

View 6fnh on RCSB PDB site
Description: Crystal Structure of Ephrin A2 (EphA2) Receptor Protein Kinase with a pyrazolo[3,4-d]pyrimidine fragment of NVP-BHG712
Class: transferase
Keywords: Inhibitor, Complex, Protein Tyrosine Kinase, Transferase
Deposited on 2018-02-04, released 2018-08-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-08, with a file datestamp of 2018-08-03.
Experiment type: XRAY
Resolution: 1.38 Å
R-factor: N/A
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ephrin type-A receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: EPHA2, ECK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fnha_
  • Chain 'B':
    Compound: Ephrin type-A receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: EPHA2, ECK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fnhb_
  • Chain 'C':
    Compound: Ephrin type-A receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: EPHA2, ECK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fnhc_
  • Heterogens: DXK, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fnhA (A:)
    gdpnqavlkftteihpscvtrqkvigagefgevykgmlktssgkkevpvaiktlkagyte
    kqrvdflgeagimgqfshhniirlegviskykpmmiiteymengaldkflrekdgefsvl
    qlvgmlrgiaagmkylanmnyvhrdlaarnilvnsnlvckvsdfglsrvleddpeatytt
    sggkipirwtapeaisyrkftsasdvwsfgivmwevmtygerpywelsnhevmkaindgf
    rlptpmdcpsaiyqlmmqcwqqerarrpkfadivsildklirapdslktladfdprvsir
    lpstsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fnhA (A:)
    lkftteihpscvtrqkvigagefgevykgmlktsgkkevpvaiktlkagytekqrvdflg
    eagimgqfshhniirlegviskykpmmiiteymengaldkflrekdgefsvlqlvgmlrg
    iaagmkylanmnyvhrdlaarnilvnsnlvckvsdfglsrvledgkipirwtapeaisyr
    kftsasdvwsfgivmwevmtygerpywelsnhevmkaindgfrlptpmdcpsaiyqlmmq
    cwqqerarrpkfadivsildklirapdslktladfdp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6fnhB (B:)
    gdpnqavlkftteihpscvtrqkvigagefgevykgmlktssgkkevpvaiktlkagyte
    kqrvdflgeagimgqfshhniirlegviskykpmmiiteymengaldkflrekdgefsvl
    qlvgmlrgiaagmkylanmnyvhrdlaarnilvnsnlvckvsdfglsrvleddpeatytt
    sggkipirwtapeaisyrkftsasdvwsfgivmwevmtygerpywelsnhevmkaindgf
    rlptpmdcpsaiyqlmmqcwqqerarrpkfadivsildklirapdslktladfdprvsir
    lpstsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fnhB (B:)
    lkftteihpscvtrqkvigagefgevykgmlktskevpvaiktlkagytekqrvdflgea
    gimgqfshhniirlegviskykpmmiiteymengaldkflrekdgefsvlqlvgmlrgia
    agmkylanmnyvhrdlaarnilvnsnlvckvsdfglsrvleddpeakipirwtapeaisy
    rkftsasdvwsfgivmwevmtygerpywelsnhevmkaindgfrlptpmdcpsaiyqlmm
    qcwqqerarrpkfadivsildklirapdslk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6fnhC (C:)
    gdpnqavlkftteihpscvtrqkvigagefgevykgmlktssgkkevpvaiktlkagyte
    kqrvdflgeagimgqfshhniirlegviskykpmmiiteymengaldkflrekdgefsvl
    qlvgmlrgiaagmkylanmnyvhrdlaarnilvnsnlvckvsdfglsrvleddpeatytt
    sggkipirwtapeaisyrkftsasdvwsfgivmwevmtygerpywelsnhevmkaindgf
    rlptpmdcpsaiyqlmmqcwqqerarrpkfadivsildklirapdslktladfdprvsir
    lpstsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fnhC (C:)
    avlkftteihpscvtrqkvigagefgevykgmlktgkkevpvaiktlkagytekqrvdfl
    geagimgqfshhniirlegviskykpmmiiteymengaldkflrekdgefsvlqlvgmlr
    giaagmkylanmnyvhrdlaarnilvnsnlvckvsdfglpirwtapeaisyrkftsasdv
    wsfgivmwevmtygerpywelsnhevmkaindgfrlptpmdcpsaiyqlmmqcwqqerar
    rpkfadivsildklirapdslktladfdpr