PDB entry 6fnb

View 6fnb on RCSB PDB site
Description: Mono- and bivalent 14-3-3 inhibitors for characterizing supramolecular lysine-PEG interactions in proteins
Class: protein binding
Keywords: Inhibition, Mono- and bivalent 14-3-3 inhibitors, Supramolecular lysine-PEG, protein binding
Deposited on 2018-02-02, released 2018-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-04, with a file datestamp of 2018-06-29.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 14-3-3 protein zeta/delta
    Species: Homo sapiens [TaxId:9606]
    Gene: YWHAZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fnba_
  • Chain 'B':
    Compound: 14-3-3 protein zeta/delta
    Species: Homo sapiens [TaxId:9606]
    Gene: YWHAZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fnbb_
  • Heterogens: BEZ, GOL, CA, CL, DWQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fnbA (A:)
    mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
    vvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylk
    mkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyye
    ilnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwts
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fnbA (A:)
    mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
    vvssieqktgaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylkm
    kgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyyei
    lnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6fnbB (B:)
    mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
    vvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylk
    mkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyye
    ilnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwts
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fnbB (B:)
    mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
    vvssieqkteaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylkm
    kgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyyei
    lnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwts