PDB entry 6fn5

View 6fn5 on RCSB PDB site
Description: Crystal structure of ERK2 in complex with an adenosine derivative
Class: transferase
Keywords: SERINE/THREONINE-PROTEIN KINASE, transferase
Deposited on 2018-02-02, released 2019-03-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-03-13, with a file datestamp of 2019-03-08.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Mapk1, Erk2, Mapk, Prkm1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6fn5a_
  • Heterogens: DVZ, DMS, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fn5A (A:)
    hhhhhhmaaaaaagpemvrgqvfdvgprytnlsyigegaygmvcsaydnlnkvrvaikki
    spfehqtycqrtlreikillrfrheniigindiiraptieqmkdvyivqdlmetdlykll
    ktqhlsndhicyflyqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadp
    dhdhtgflteyvatrwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldq
    lnhilgilgspsqedlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltf
    nphkrieveqalahpyleqyydpsdepiaeapfkfdmelddlpkeklkelifeetarfqp
    gyrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fn5A (A:)
    pemvrgqvfdvgprytnlsyigeygmvcsaydnlnkvrvaikkispfehqtycqrtlrei
    killrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsndhicyflyq
    ilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgflteyvatrw
    yrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgspsqedl
    nciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqalahpy
    leqyydpsdepiaeapflpkeklkelifeetarfqp