PDB entry 6fn3

View 6fn3 on RCSB PDB site
Description: X-ray structure of animal-like Cryptochrome from Chlamydomonas reinhardtii
Class: flavoprotein
Keywords: Cryptochrome, Photolyase, Photoreceptor, FLAVOPROTEIN
Deposited on 2018-02-02, released 2018-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-01, with a file datestamp of 2018-07-27.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cryptochrome photoreceptor
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Gene: UVR3, CHLREDRAFT_206002
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fn3a1, d6fn3a2
  • Heterogens: MES, FAD, GOL, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fn3A (A:)
    magvknsiiwfrkglrlhdnpalleackdakhvypvfvldphflqqssykvsvnrynfll
    esledlqrsfqargsrllvlrgkpeevfprvfrewgvtqlcfehdtepyakvrdaavrrl
    aaeagvevvtpishtlydtdmlvarnggaapltmqsftklvdrvgdppapapdppaampp
    paedmpsaapaatgvptwqevgfkeppltvfkggetealarleaafqdpkwvagfqkpdt
    dpsawekpattvlspylkfgclsarlfharllevyrrhpahsqppvslrgqllwreffyt
    vgsttpnfhrmagnpvckqidwddnpeflaawreartgfpwidaimtqlvtwgwmhhlar
    hsvacfltrgdlyvswergmevfeehlidqdhylnaanwmwlsasaffsqyfrvyspvvf
    gkkydpegrfirkflpvlkdmpakyiyepwtaplevqrkagcvvgrdypapivdhavask
    aciarmaaayrrskgeklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fn3A (A:)
    gvknsiiwfrkglrlhdnpalleackdakhvypvfvldphflqqkvsvnrynfllesled
    lqrsfqargsrllvlrgkpeevfprvfrewgvtqlcfehdtepyakvrdaavrrlaaeag
    vevvtpishtlydtdmlvarnggaapltmqsftklvdrvgdppapapdppaampppaedm
    psaapaatgvptwqevgfkeppltvfkggetealarleaafqdpkwvagfqkpdtdpsaw
    ekpattvlspylkfgclsarlfharllevyrrhpahsqppvslrgqllwreffytvgstt
    pnfhrmagnpvckqidwddnpeflaawreartgfpwidaimtqlvtwgwmhhlarhsvac
    fltrgdlyvswergmevfeehlidqdhylnaanwmwlsasaffsqyfrvyspvvfgkkyd
    pegrfirkflpvlkdmpakyiyepwtaplevqrkagcvvgrdypapivdhavaskaciar
    maaayrrsk