PDB entry 6fm6

View 6fm6 on RCSB PDB site
Description: Crystal structure of the class C beta-lactamase TRU-1 from Aeromonas enteropelogenes
Class: hydrolase
Keywords: class C, serine beta-lactamase, TRU-1, Aeromonas enteropelogenes, HYDROLASE
Deposited on 2018-01-30, released 2018-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-30, with a file datestamp of 2018-05-25.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: N/A
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Aeromonas enteropelogenes [TaxId:29489]
    Gene: AMPC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fm6a_
  • Heterogens: SO4, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fm6A (A:)
    mkqrialsllalgplllvprvyaaadepmanivekavqplleeyripgmavavlkegkph
    yfnygvanresgrrisertlfeigsvsktftatlgtyavvkggfrlddkvsqhapwlqns
    afdrvtmaqlatysagglplqfpdavdsnermrqyyrqwsplyaagthreysnpsiglfg
    hlaastlgqpfrqlmsqtllpkldlqhtylevpdaamvdyaygyskedkpvrvnpgvlad
    eaygiktsaadlikfvganmtgsgdkavqqalamtrtgfysvgemtqglgwesyaypvte
    qallagnspavsfkanpvkpfvaprvmgnerlynktgstngfgayvvfvpargvgivmla
    nrnypiearvkaayaimrhlap
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fm6A (A:)
    epmanivekavqplleeyripgmavavlkegkphyfnygvanresgrrisertlfeigsv
    sktftatlgtyavvkggfrlddkvsqhapwlqnsafdrvtmaqlatysagglplqfpdav
    dsnermrqyyrqwsplyaagthreysnpsiglfghlaastlgqpfrqlmsqtllpkldlq
    htylevpdaamvdyaygyskedkpvrvnpgvladeaygiktsaadlikfvganmtgsgdk
    avqqalamtrtgfysvgemtqglgwesyaypvteqallagnspavsfkanpvkpfvaprv
    mgnerlynktgstngfgayvvfvpargvgivmlanrnypiearvkaayaimrhlap