PDB entry 6flz

View 6flz on RCSB PDB site
Description: Structure of AcmJRL, a mannose binding jacalin related lectin from Ananas comosus, in complex with methyl-mannose.
Class: sugar binding protein
Keywords: mannose binding lectin, A. comosus stem, sugar binding protein
Deposited on 2018-01-29, released 2018-08-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-15, with a file datestamp of 2018-08-10.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Jacalin-like lectin
    Species: Ananas comosus [TaxId:4615]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6flza_
  • Chain 'B':
    Compound: Jacalin-like lectin
    Species: Ananas comosus [TaxId:4615]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6flzb_
  • Heterogens: MMA, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6flzA (A:)
    sglvklglwggnegtlqdidghptrltkivirsahaidalqfdyvedgktfaagqwggng
    gksdtiefqpgeyliaikgttgalgavtnlvrsltfisnmrtygpfglehgtpfsvpvas
    grivafygrfgslvdafgiylmpy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6flzB (B:)
    sglvklglwggnegtlqdidghptrltkivirsahaidalqfdyvedgktfaagqwggng
    gksdtiefqpgeyliaikgttgalgavtnlvrsltfisnmrtygpfglehgtpfsvpvas
    grivafygrfgslvdafgiylmpy