PDB entry 6flz

View 6flz on RCSB PDB site
Description: Structure of AcmJRL, a mannose binding jacalin related lectin from Ananas comosus, in complex with methyl-mannose.
Class: sugar binding protein
Keywords: mannose binding lectin, A. comosus stem, sugar binding protein
Deposited on 2018-01-29, released 2018-08-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Jacalin-like lectin
    Species: Ananas comosus [TaxId:4615]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6flza_
  • Chain 'B':
    Compound: Jacalin-like lectin
    Species: Ananas comosus [TaxId:4615]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6flzb_
  • Heterogens: MMA, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6flzA (A:)
sglvklglwggnegtlqdidghptrltkivirsahaidalqfdyvedgktfaagqwggng
gksdtiefqpgeyliaikgttgalgavtnlvrsltfisnmrtygpfglehgtpfsvpvas
grivafygrfgslvdafgiylmpy

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6flzB (B:)
sglvklglwggnegtlqdidghptrltkivirsahaidalqfdyvedgktfaagqwggng
gksdtiefqpgeyliaikgttgalgavtnlvrsltfisnmrtygpfglehgtpfsvpvas
grivafygrfgslvdafgiylmpy