PDB entry 6flr

View 6flr on RCSB PDB site
Description: Super-open structure of the AMPAR GluA3 N-terminal domain
Class: membrane protein
Keywords: ligand-gated ion channel, membrane protein, AMPA receptor
Deposited on 2018-01-27, released 2018-12-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.51 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate receptor 3
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gria3, Glur3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6flra_
  • Chain 'B':
    Compound: Glutamate receptor 3
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gria3, Glur3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6flrb_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6flrA (A:)
    gfpntisigglfmrntvqehsafrfavqlyntnqnttekpfhlnyhvdhldssnsfsvtn
    afcsqfsrgvyaifgfydqmsmntltsfcgalhtsfvtpsfptdadvqfviqmrpalkga
    ilsllsyykwekfvylydtergfsvlqaimeaavqnnwqvtarsvgnikdvqefrriiee
    mdrrqekrylidceverintileqvvilgkhsrgyhymlanlgftdillervmhgganit
    gfqivnnenpmvqqfiqrwvrlderefpeaknaplkytsalthdailviaeafrylrrqr
    vdvsrrgsagdclanpavpwsqgidieralkmvqvqgmtgniqfdtygrrtnytidvyem
    kvsgsrkagywneyerfvpfsgthhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6flrA (A:)
    fpntisigglfmrntvqehsafrfavqlyntnqnttekpfhlnyhvdhldssnsfsvtna
    fcsqfsrgvyaifgfydqmsmntltsfcgalhtsfvtpsfptdadvqfviqmrpalkgai
    lsllsyykwekfvylydtergfsvlqaimeaavqnnwqvtarsvgnikdvqefrriieem
    drrqekrylidceverintileqvvilgkhsrgyhymlanlgftdillervmhgganitg
    fqivnnenpmvqqfiqrwvrlderefpeaknaplkytsalthdailviaeafrylrrqrv
    dvsdclanpavpwsqgidieralkmvqvqgmtgniqfdtygrrtnytidvyemsrkagyw
    neyerfvpfs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6flrB (B:)
    gfpntisigglfmrntvqehsafrfavqlyntnqnttekpfhlnyhvdhldssnsfsvtn
    afcsqfsrgvyaifgfydqmsmntltsfcgalhtsfvtpsfptdadvqfviqmrpalkga
    ilsllsyykwekfvylydtergfsvlqaimeaavqnnwqvtarsvgnikdvqefrriiee
    mdrrqekrylidceverintileqvvilgkhsrgyhymlanlgftdillervmhgganit
    gfqivnnenpmvqqfiqrwvrlderefpeaknaplkytsalthdailviaeafrylrrqr
    vdvsrrgsagdclanpavpwsqgidieralkmvqvqgmtgniqfdtygrrtnytidvyem
    kvsgsrkagywneyerfvpfsgthhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6flrB (B:)
    fpntisigglfmrntvqehsafrfavqlyntnnttekpfhlnyhvdhldssnsfsvtnaf
    csqfsrgvyaifgfydqmsmntltsfcgalhtsfvtpsfptdadvqfviqmrpalkgail
    sllsyykwekfvylydtergfsvlqaimeaavqnnwqvtarsvgnikdvqefrriieemd
    rrqekrylidceverintileqvvilgkhsrgyhymlanlgftdillervmhgganitgf
    qivnnenpmvqqfiqrwvrlderefpeaknaplkytsalthdailviaeafrylrrqrvd
    vsgdclanpavpwsqgidieralkmvqvqgmtgniqfdtygrrtnytidvyemsgsrkag
    ywneyerfvpf