PDB entry 6flh

View 6flh on RCSB PDB site
Description: monomeric human cu,zn superoxide dismutase, sod1 7+7, apo form
Deposited on 2018-01-25, released 2018-11-07
The last revision was dated 2019-10-16, with a file datestamp of 2019-10-11.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-117)
      • conflict (5)
      • conflict (49)
      • conflict (51-52)
      • conflict (84)
      • conflict (99-101)
      • conflict (110)
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6flhA (A:)
atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvheegaghvgdlgn
vtadkdgvadvsiedsvislsgdhsiigrtlvvhekaddgaggnagsrlasgvigiaq