PDB entry 6flc

View 6flc on RCSB PDB site
Description: 2C8 Fab bound to EDIII of DenV 2
Class: viral protein
Keywords: Dengue virus, antibody, macromolecular complex, VIRAL PROTEIN
Deposited on 2018-01-25, released 2018-10-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-24, with a file datestamp of 2018-10-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Light chain of 2C8 Fab
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FLC (0-End)
    Domains in SCOPe 2.07: d6flca1, d6flca2
  • Chain 'B':
    Compound: Heavy chain of 2C8 Fab
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FLC (0-End)
  • Chain 'G':
    Compound: Domain III of Dengue virus 2
    Species: Dengue virus 2 [TaxId:11060]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6flcg_
  • Chain 'H':
    Compound: Heavy chain of 2C8 Fab
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FLC (0-End)
  • Chain 'I':
    Compound: Domain III of Dengue virus 2
    Species: Dengue virus 2 [TaxId:11060]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6flci_
  • Chain 'L':
    Compound: Light chain of 2C8 Fab
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FLC (0-End)
    Domains in SCOPe 2.07: d6flcl1, d6flcl2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6flcA (A:)
    diqmtqspaslsvsvgetvtitcratkniynnlawyqqkqgrspqllvyaatnladgvps
    rfsgsgsgtqfslrinslqsedfgnyycqhfwhtpwtfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6flcA (A:)
    diqmtqspaslsvsvgetvtitcratkniynnlawyqqkqgrspqllvyaatnladgvps
    rfsgsgsgtqfslrinslqsedfgnyycqhfwhtpwtfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'B':
    No sequence available.

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6flcG (G:)
    msysmctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnp
    ivtekdspvnieaeppfgdsyiiigvepgqlklnwfkk
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >6flcI (I:)
    msysmctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnp
    ivtekdspvnieaeppfgdsyiiigvepgqlklnwfkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6flcI (I:)
    msysmctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnp
    ivtekdspvnieaeppfgdsyiiigvepgqlklnwfk
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6flcL (L:)
    diqmtqspaslsvsvgetvtitcratkniynnlawyqqkqgrspqllvyaatnladgvps
    rfsgsgsgtqfslrinslqsedfgnyycqhfwhtpwtfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6flcL (L:)
    diqmtqspaslsvsvgetvtitcratkniynnlawyqqkqgrspqllvyaatnladgvps
    rfsgsgsgtqfslrinslqsedfgnyycqhfwhtpwtfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn