PDB entry 6fl1

View 6fl1 on RCSB PDB site
Description: crystal structure of the complex between the lactococcus lactis fpg mutant t221p and a fapy-dg containing dna
Deposited on 2018-01-25, released 2019-02-06
The last revision was dated 2019-02-06, with a file datestamp of 2019-02-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: formamidopyrimidine-DNA glycosylase
    Species: Lactococcus lactis subsp. cremoris [TaxId:1359]
    Gene: mutM, fpg, NCDO763_0992
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A165FVI1 (0-270)
      • engineered mutation (220)
  • Chain 'B':
    Compound: DNA (5'-d(*cp*tp*cp*tp*tp*tp(fox)p*tp*tp*tp*cp*tp*cp*g)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'C':
    Compound: DNA (5'-d(*gp*cp*gp*ap*gp*ap*ap*ap*cp*ap*ap*ap*gp*a)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Heterogens: ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6fl1A (A:)
pelpevetvrrelekrivgqkiisieatyprmvltgfeqlkkeltgktiqgisrrgkyli
feigddfrlishlrmegkyrlatldaprekhdhltmkfadgqliyadvrkfgtwelistd
qvlpyflkkkigpeptyedfdeklfreklrkstkkikpylleqtlvaglgniyvdevlwl
akihpeketnqliessihllhdsiieilqkaiklggssirpysalgstgkmqnelqvygk
tgekcsrcgaeiqkikvagrgthfcpvcqqk

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.