PDB entry 6fkz

View 6fkz on RCSB PDB site
Description: crystal structure of zebrafish sirtuin 5 in complex with 3- (phenylthio)succinyl-cps1 peptide
Deposited on 2018-01-25, released 2018-05-16
The last revision was dated 2018-05-16, with a file datestamp of 2018-05-11.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NAD-dependent protein deacylase sirtuin-5, mitochondrial
    Species: Danio rerio [TaxId:7955]
    Gene: sirt5, si:ch211-121a2.1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: NAD-dependent protein deacylase sirtuin-5, mitochondrial
    Species: Danio rerio [TaxId:7955]
    Gene: sirt5, si:ch211-121a2.1
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: 3(S)-(phenylthio)succinyl-CPS1 peptide
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FKZ (0-7)
  • Chain 'H':
    Compound: 3(R)-(phenylthio)succinyl-CPS1 peptide
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FKZ (0-7)
  • Heterogens: EYZ, DQK, ZN, GOL, EPE, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6fkzA (A:)
    gidpftkmtrpssdltafrehfakakhiaiitgagvsaesgvptfrgpggfwrkwqaqdl
    atpeafsrdpslvwefyhyrrevmrskmpnpahlaiaecearlgqqgrsvviitqnidel
    hhragskhvyeihgslfktrcmscgevkanhkspicpaldgkgapdpntkearipvellp
    rcerkscngllrphvvwfgetldsdiltaverelekcdlclvvgtssivypaamfapqva
    srgvpvaefnmectpatqrfkyhfegpcgstlppalerheseav
    

    Sequence, based on observed residues (ATOM records):
    >6fkzA (A:)
    dltafrehfakakhiaiitgagvsaesgvptfrgpggfwrkwqaqdlatpeafsrdpslv
    wefyhyrrevmrskmpnpahlaiaecearlgqqgrsvviitqnidelhhragskhvyeih
    gslfktrcmscgevkanhkspicpaldgkgapdpntkearipvellprcerkscngllrp
    hvvwfgetldsdiltaverelekcdlclvvgtssivypaamfapqvasrgvpvaefnmec
    tpatqrfkyhfegpcgstlppale
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6fkzB (B:)
    gidpftkmtrpssdltafrehfakakhiaiitgagvsaesgvptfrgpggfwrkwqaqdl
    atpeafsrdpslvwefyhyrrevmrskmpnpahlaiaecearlgqqgrsvviitqnidel
    hhragskhvyeihgslfktrcmscgevkanhkspicpaldgkgapdpntkearipvellp
    rcerkscngllrphvvwfgetldsdiltaverelekcdlclvvgtssivypaamfapqva
    srgvpvaefnmectpatqrfkyhfegpcgstlppalerheseav
    

    Sequence, based on observed residues (ATOM records):
    >6fkzB (B:)
    ssdltafrehfakakhiaiitgagvsaesgvptfrgpggfwrkwqaqdlatpeafsrdps
    lvwefyhyrrevmrskmpnpahlaiaecearlgqqgrsvviitqnidelhhragskhvye
    ihgslfktrcmscgevkanhkspicpaldgkgapdpntkearipvellprcerkscngll
    rphvvwfgetldsdiltaverelekcdlclvvgtssivypaamfapqvasrgvpvaefnm
    ectpatqrfkyhfegpcgstlppale
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records:
    >6fkzE (E:)
    xvlxeygv
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records:
    >6fkzH (H:)
    xvlxeygv