PDB entry 6fki

View 6fki on RCSB PDB site
Description: chloroplast f1fo conformation 3
Deposited on 2018-01-24, released 2018-05-23
The last revision was dated 2019-10-23, with a file datestamp of 2019-10-18.
Experiment type: EM
Resolution: 4.3 Å
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP synthase subunit alpha, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: ATP synthase subunit beta, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: ATP synthase subunit alpha, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: ATP synthase subunit beta, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: ATP synthase subunit alpha, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: ATP synthase subunit beta, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: ATP synthase subunit c, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: ATP synthase subunit c, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: ATP synthase subunit c, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: ATP synthase subunit c, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: ATP synthase subunit c, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: ATP synthase subunit c, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: ATP synthase subunit c, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: ATP synthase subunit c, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: ATP synthase subunit c, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: ATP synthase subunit c, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: ATP synthase subunit c, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: ATP synthase subunit c, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: ATP synthase subunit c, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'T':
    Compound: ATP synthase subunit c, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'a':
    Compound: ATP synthase subunit a, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'b':
    Compound: ATP synthase subunit b, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'd':
    Compound: ATP synthase delta chain, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'e':
    Compound: ATP synthase epsilon chain, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'g':
    Compound: ATP synthase gamma chain, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'p':
    Compound: ATP synthase subunit b', chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ATP, MG, ADP

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6fkiA (A:)
    matiradeiskiireriegynrevkvvntgtvlqvgdgiarihgldevmagelvefeegt
    igialnlesnnvgvvlmgdglmiqegssvkatgriaqipvseaylgrvinalakpidgrg
    eitasesrliespapgimsrrsvyeplqtgliaidamipvgrgqreliigdrqtgktava
    tdtilnqqgqnvicvyvaigqkassvaqvvtnfqergameytivvaetadspatlqylap
    ytgaalaeyfmyrerhtliiyddlskqaqayrqmslllrrppgreaypgdvfylhsrlle
    raaklssllgegsmtalpivetqagdvsayiptnvisitdgqiflsadlfnagirpainv
    gisvsrvgsaaqikamkkvagklklelaqfaeleafaqfasdldkatqnqlargqrlrel
    lkqpqsapltveeqvmtiytgtngyldsleldqvrkylvelrtyvktnkpefqeiisstk
    tfteeaeallkeaiqeqmerfllqeqa
    

    Sequence, based on observed residues (ATOM records):
    >6fkiA (A:)
    tiradeiskiireriegynrevkvvntgtvlqvgdgiarihgldevmagelvefeegtig
    ialnlesnnvgvvlmgdglmiqegssvkatgriaqipvseaylgrvinalakpidgrgei
    tasesrliespapgimsrrsvyeplqtgliaidamipvgrgqreliigdrqtgktavatd
    tilnqqgqnvicvyvaigqkassvaqvvtnfqergameytivvaetadspatlqylapyt
    gaalaeyfmyrerhtliiyddlskqaqayrqmslllrrppgreaypgdvfylhsrllera
    aklssllgegsmtalpivetqagdvsayiptnvisitdgqiflsadlfnagirpainvgi
    svsrvgsaaqikamkkvagklklelaqfaeleafaqfasdldkatqnqlargqrlrellk
    qpqsapltveeqvmtiytgtngyldsleldqvrkylvelrtyvktnkpefqeiisstktf
    teeaeallkeaiqeqmerfll
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6fkiB (B:)
    mrinpttsdpgvstlekknlgriaqiigpvldvafppgkmpniynalivkgrdtagqpmn
    vtcevqqllgnnrvravamsatdgltrgmevidtgaplsvpvggatlgrifnvlgepvdn
    lgpvdtrttspihrsapaftqldtklsifetgikvvdllapyrrggkiglfggagvgktv
    limelinniakahggvsvfggvgertregndlymemkesgvineqniaeskvalvygqmn
    eppgarmrvgltaltmaeyfrdvneqdvllfidnifrfvqagsevsallgrmpsavgyqp
    tlstemgslqeritstkegsitsiqavyvpaddltdpapattfahldattvlsrglaakg
    iypavdpldststmlqprivgeehyeiaqrvketlqrykelqdiiailgldelseedrlt
    vararkierflsqpffvaevftgspgkyvglaetirgfqlilsgeldslpeqafylvgni
    deatakamnlemesklkk
    

    Sequence, based on observed residues (ATOM records):
    >6fkiB (B:)
    kknlgriaqiigpvldvafppgkmpniynalivkgrdtagqpmnvtcevqqllgnnrvra
    vamsatdgltrgmevidtgaplsvpvggatlgrifnvlgepvdnlgpvdtrttspihrsa
    paftqldtklsifetgikvvdllapyrrggkiglfggagvgktvlimelinniakahggv
    svfggvgertregndlymemkesgvineqniaeskvalvygqmneppgarmrvgltaltm
    aeyfrdvneqdvllfidnifrfvqagsevsallgrmpsavgyqptlstemgslqeritst
    kegsitsiqavyvpaddltdpapattfahldattvlsrglaakgiypavdpldststmlq
    privgeehyeiaqrvketlqrykelqdiiailgldelseedrltvararkierflsqpff
    vaevftgspgkyvglaetirgfqlilsgeldslpeqafylvgnideatakamnlemes
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >6fkiC (C:)
    matiradeiskiireriegynrevkvvntgtvlqvgdgiarihgldevmagelvefeegt
    igialnlesnnvgvvlmgdglmiqegssvkatgriaqipvseaylgrvinalakpidgrg
    eitasesrliespapgimsrrsvyeplqtgliaidamipvgrgqreliigdrqtgktava
    tdtilnqqgqnvicvyvaigqkassvaqvvtnfqergameytivvaetadspatlqylap
    ytgaalaeyfmyrerhtliiyddlskqaqayrqmslllrrppgreaypgdvfylhsrlle
    raaklssllgegsmtalpivetqagdvsayiptnvisitdgqiflsadlfnagirpainv
    gisvsrvgsaaqikamkkvagklklelaqfaeleafaqfasdldkatqnqlargqrlrel
    lkqpqsapltveeqvmtiytgtngyldsleldqvrkylvelrtyvktnkpefqeiisstk
    tfteeaeallkeaiqeqmerfllqeqa
    

    Sequence, based on observed residues (ATOM records):
    >6fkiC (C:)
    iradeiskiireriegynrevkvvntgtvlqvgdgiarihgldevmagelvefeegtigi
    alnlesnnvgvvlmgdglmiqegssvkatgriaqipvseaylgrvinalakpidgrgeit
    asesrliespapgimsrrsvyeplqtgliaidamipvgrgqreliigdrqtgktavatdt
    ilnqqgqnvicvyvaigqkassvaqvvtnfqergameytivvaetadspatlqylapytg
    aalaeyfmyrerhtliiyddlskqaqayrqmslllrrppgreaypgdvfylhsrlleraa
    klssllgegsmtalpivetqagdvsayiptnvisitdgqiflsadlfnagirpainvgis
    vsrvgsaaqikamkkvagklklelaqfaeleafaqfasdldkatqnqlargqrlrellkq
    pqsapltveeqvmtiytgtngyldsleldqvrkylvelrtyvktnkpefqeiisstktft
    eeaeallkeaiqeqmerfllq
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >6fkiD (D:)
    mrinpttsdpgvstlekknlgriaqiigpvldvafppgkmpniynalivkgrdtagqpmn
    vtcevqqllgnnrvravamsatdgltrgmevidtgaplsvpvggatlgrifnvlgepvdn
    lgpvdtrttspihrsapaftqldtklsifetgikvvdllapyrrggkiglfggagvgktv
    limelinniakahggvsvfggvgertregndlymemkesgvineqniaeskvalvygqmn
    eppgarmrvgltaltmaeyfrdvneqdvllfidnifrfvqagsevsallgrmpsavgyqp
    tlstemgslqeritstkegsitsiqavyvpaddltdpapattfahldattvlsrglaakg
    iypavdpldststmlqprivgeehyeiaqrvketlqrykelqdiiailgldelseedrlt
    vararkierflsqpffvaevftgspgkyvglaetirgfqlilsgeldslpeqafylvgni
    deatakamnlemesklkk
    

    Sequence, based on observed residues (ATOM records):
    >6fkiD (D:)
    kknlgriaqiigpvldvafppgkmpniynalivkgrdtagqpmnvtcevqqllgnnrvra
    vamsatdgltrgmevidtgaplsvpvggatlgrifnvlgepvdnlgpvdtrttspihrsa
    paftqldtklsifetgikvvdllapyrrggkiglfggagvgktvlimelinniakahggv
    svfggvgertregndlymemkesgvineqniaeskvalvygqmneppgarmrvgltaltm
    aeyfrdvneqdvllfidnifrfvqagsevsallgrmpsavgyqptlstemgslqeritst
    kegsitsiqavyvpaddltdpapattfahldattvlsrglaakgiypavdpldststmlq
    privgeehyeiaqrvketlqrykelqdiiailgldelseedrltvararkierflsqpff
    vaevftgspgkyvglaetirgfqlilsgeldslpeqafylvgnideatakamnlemeskl
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >6fkiE (E:)
    matiradeiskiireriegynrevkvvntgtvlqvgdgiarihgldevmagelvefeegt
    igialnlesnnvgvvlmgdglmiqegssvkatgriaqipvseaylgrvinalakpidgrg
    eitasesrliespapgimsrrsvyeplqtgliaidamipvgrgqreliigdrqtgktava
    tdtilnqqgqnvicvyvaigqkassvaqvvtnfqergameytivvaetadspatlqylap
    ytgaalaeyfmyrerhtliiyddlskqaqayrqmslllrrppgreaypgdvfylhsrlle
    raaklssllgegsmtalpivetqagdvsayiptnvisitdgqiflsadlfnagirpainv
    gisvsrvgsaaqikamkkvagklklelaqfaeleafaqfasdldkatqnqlargqrlrel
    lkqpqsapltveeqvmtiytgtngyldsleldqvrkylvelrtyvktnkpefqeiisstk
    tfteeaeallkeaiqeqmerfllqeqa
    

    Sequence, based on observed residues (ATOM records):
    >6fkiE (E:)
    deiskiireriegynrevkvvntgtvlqvgdgiarihgldevmagelvefeegtigialn
    lesnnvgvvlmgdglmiqegssvkatgriaqipvseaylgrvinalakpidgrgeitase
    srliespapgimsrrsvyeplqtgliaidamipvgrgqreliigdrqtgktavatdtiln
    qqgqnvicvyvaigqkassvaqvvtnfqergameytivvaetadspatlqylapytgaal
    aeyfmyrerhtliiyddlskqaqayrqmslllrrppgreaypgdvfylhsrlleraakls
    sllgegsmtalpivetqagdvsayiptnvisitdgqiflsadlfnagirpainvgisvsr
    vgsaaqikamkkvagklklelaqfaeleafaqfasdldkatqnqlargqrlrellkqpqs
    apltveeqvmtiytgtngyldsleldqvrkylvelrtyvktnkpefqeiisstktfteea
    eallkeaiqeqmerfllq
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >6fkiF (F:)
    mrinpttsdpgvstlekknlgriaqiigpvldvafppgkmpniynalivkgrdtagqpmn
    vtcevqqllgnnrvravamsatdgltrgmevidtgaplsvpvggatlgrifnvlgepvdn
    lgpvdtrttspihrsapaftqldtklsifetgikvvdllapyrrggkiglfggagvgktv
    limelinniakahggvsvfggvgertregndlymemkesgvineqniaeskvalvygqmn
    eppgarmrvgltaltmaeyfrdvneqdvllfidnifrfvqagsevsallgrmpsavgyqp
    tlstemgslqeritstkegsitsiqavyvpaddltdpapattfahldattvlsrglaakg
    iypavdpldststmlqprivgeehyeiaqrvketlqrykelqdiiailgldelseedrlt
    vararkierflsqpffvaevftgspgkyvglaetirgfqlilsgeldslpeqafylvgni
    deatakamnlemesklkk
    

    Sequence, based on observed residues (ATOM records):
    >6fkiF (F:)
    knlgriaqiigpvldvafppgkmpniynalivkgrdtagqpmnvtcevqqllgnnrvrav
    amsatdgltrgmevidtgaplsvpvggatlgrifnvlgepvdnlgpvdtrttspihrsap
    aftqldtklsifetgikvvdllapyrrggkiglfggagvgktvlimelinniakahggvs
    vfggvgertregndlymemkesgvineqniaeskvalvygqmneppgarmrvgltaltma
    eyfrdvneqdvllfidnifrfvqagsevsallgrmpsavgyqptlstemgslqeritstk
    egsitsiqavyvpaddltdpapattfahldattvlsrglaakgiypavdpldststmlqp
    rivgeehyeiaqrvketlqrykelqdiiailgldelseedrltvararkierflsqpffv
    aevftgspgkyvglaetirgfqlilsgeldslpeqafylvgnideatakamnlemeskl
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >6fkiG (G:)
    mnpliaaasviaaglavglasigpgvgqgtaagqavegiarqpeaegkirgtlllslafm
    ealtiyglvvalallfanpfv
    

    Sequence, based on observed residues (ATOM records):
    >6fkiG (G:)
    pliaaasviaaglavglasigpgvgqgtaagqavegiarqpeaegkirgtlllslafmea
    ltiyglvvalallfanpfv
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >6fkiH (H:)
    mnpliaaasviaaglavglasigpgvgqgtaagqavegiarqpeaegkirgtlllslafm
    ealtiyglvvalallfanpfv
    

    Sequence, based on observed residues (ATOM records):
    >6fkiH (H:)
    pliaaasviaaglavglasigpgvgqgtaagqavegiarqpeaegkirgtlllslafmea
    ltiyglvvalallfanpfv
    

  • Chain 'I':
    Sequence, based on SEQRES records:
    >6fkiI (I:)
    mnpliaaasviaaglavglasigpgvgqgtaagqavegiarqpeaegkirgtlllslafm
    ealtiyglvvalallfanpfv
    

    Sequence, based on observed residues (ATOM records):
    >6fkiI (I:)
    pliaaasviaaglavglasigpgvgqgtaagqavegiarqpeaegkirgtlllslafmea
    ltiyglvvalallfanpfv
    

  • Chain 'J':
    Sequence, based on SEQRES records:
    >6fkiJ (J:)
    mnpliaaasviaaglavglasigpgvgqgtaagqavegiarqpeaegkirgtlllslafm
    ealtiyglvvalallfanpfv
    

    Sequence, based on observed residues (ATOM records):
    >6fkiJ (J:)
    pliaaasviaaglavglasigpgvgqgtaagqavegiarqpeaegkirgtlllslafmea
    ltiyglvvalallfanpfv
    

  • Chain 'K':
    Sequence, based on SEQRES records:
    >6fkiK (K:)
    mnpliaaasviaaglavglasigpgvgqgtaagqavegiarqpeaegkirgtlllslafm
    ealtiyglvvalallfanpfv
    

    Sequence, based on observed residues (ATOM records):
    >6fkiK (K:)
    pliaaasviaaglavglasigpgvgqgtaagqavegiarqpeaegkirgtlllslafmea
    ltiyglvvalallfanpfv
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >6fkiL (L:)
    mnpliaaasviaaglavglasigpgvgqgtaagqavegiarqpeaegkirgtlllslafm
    ealtiyglvvalallfanpfv
    

    Sequence, based on observed residues (ATOM records):
    >6fkiL (L:)
    pliaaasviaaglavglasigpgvgqgtaagqavegiarqpeaegkirgtlllslafmea
    ltiyglvvalallfanpfv
    

  • Chain 'M':
    Sequence, based on SEQRES records:
    >6fkiM (M:)
    mnpliaaasviaaglavglasigpgvgqgtaagqavegiarqpeaegkirgtlllslafm
    ealtiyglvvalallfanpfv
    

    Sequence, based on observed residues (ATOM records):
    >6fkiM (M:)
    pliaaasviaaglavglasigpgvgqgtaagqavegiarqpeaegkirgtlllslafmea
    ltiyglvvalallfanpfv
    

  • Chain 'N':
    Sequence, based on SEQRES records:
    >6fkiN (N:)
    mnpliaaasviaaglavglasigpgvgqgtaagqavegiarqpeaegkirgtlllslafm
    ealtiyglvvalallfanpfv
    

    Sequence, based on observed residues (ATOM records):
    >6fkiN (N:)
    pliaaasviaaglavglasigpgvgqgtaagqavegiarqpeaegkirgtlllslafmea
    ltiyglvvalallfanpfv
    

  • Chain 'O':
    Sequence, based on SEQRES records:
    >6fkiO (O:)
    mnpliaaasviaaglavglasigpgvgqgtaagqavegiarqpeaegkirgtlllslafm
    ealtiyglvvalallfanpfv
    

    Sequence, based on observed residues (ATOM records):
    >6fkiO (O:)
    pliaaasviaaglavglasigpgvgqgtaagqavegiarqpeaegkirgtlllslafmea
    ltiyglvvalallfanpfv
    

  • Chain 'P':
    Sequence, based on SEQRES records:
    >6fkiP (P:)
    mnpliaaasviaaglavglasigpgvgqgtaagqavegiarqpeaegkirgtlllslafm
    ealtiyglvvalallfanpfv
    

    Sequence, based on observed residues (ATOM records):
    >6fkiP (P:)
    pliaaasviaaglavglasigpgvgqgtaagqavegiarqpeaegkirgtlllslafmea
    ltiyglvvalallfanpfv
    

  • Chain 'Q':
    Sequence, based on SEQRES records:
    >6fkiQ (Q:)
    mnpliaaasviaaglavglasigpgvgqgtaagqavegiarqpeaegkirgtlllslafm
    ealtiyglvvalallfanpfv
    

    Sequence, based on observed residues (ATOM records):
    >6fkiQ (Q:)
    pliaaasviaaglavglasigpgvgqgtaagqavegiarqpeaegkirgtlllslafmea
    ltiyglvvalallfanpfv
    

  • Chain 'R':
    Sequence, based on SEQRES records:
    >6fkiR (R:)
    mnpliaaasviaaglavglasigpgvgqgtaagqavegiarqpeaegkirgtlllslafm
    ealtiyglvvalallfanpfv
    

    Sequence, based on observed residues (ATOM records):
    >6fkiR (R:)
    pliaaasviaaglavglasigpgvgqgtaagqavegiarqpeaegkirgtlllslafmea
    ltiyglvvalallfanpfv
    

  • Chain 'S':
    Sequence, based on SEQRES records:
    >6fkiS (S:)
    mnpliaaasviaaglavglasigpgvgqgtaagqavegiarqpeaegkirgtlllslafm
    ealtiyglvvalallfanpfv
    

    Sequence, based on observed residues (ATOM records):
    >6fkiS (S:)
    pliaaasviaaglavglasigpgvgqgtaagqavegiarqpeaegkirgtlllslafmea
    ltiyglvvalallfanpfv
    

  • Chain 'T':
    Sequence, based on SEQRES records:
    >6fkiT (T:)
    mnpliaaasviaaglavglasigpgvgqgtaagqavegiarqpeaegkirgtlllslafm
    ealtiyglvvalallfanpfv
    

    Sequence, based on observed residues (ATOM records):
    >6fkiT (T:)
    pliaaasviaaglavglasigpgvgqgtaagqavegiarqpeaegkirgtlllslafmea
    ltiyglvvalallfanpfv
    

  • Chain 'a':
    Sequence, based on SEQRES records:
    >6fkia (a:)
    mnvlsysinplkglyaisgvevgqhfywqiggfqihgqvlitswvviaillgsaaiavrs
    pqtiptggqnffeyvlefirdvsktqigeeyrpwvpfigtmflfifvsnwsgallpwkii
    qlphgelaaptndinttvalalltsvayfyagltkkglgyfgkyiqptpillpiniledf
    tkplslsfrlfgniladelvvvvlvslvplvvpipvmflglftsgiqalifatlaaayig
    esleghh
    

    Sequence, based on observed residues (ATOM records):
    >6fkia (a:)
    vgqhfywqiggfqihgqvlitswvviaillgsaaiavrspqtiptggqnffeyvlefird
    vsktqigeeyrpwvpfigtmflfifvsnwsgallpwkiiqlphgelaaptndinttvala
    lltsvayfyagltkkglgyfgkyiqptpillpiniledftkplslsfrlfgniladelvv
    vvlvslvplvvpipvmflglftsgiqalifatlaaayigesle
    

  • Chain 'b':
    Sequence, based on SEQRES records:
    >6fkib (b:)
    mknvtdsfvflghwpsagsfgfntdilatnlinlsvvlgvliffgkgvlsdlldnrkqri
    lntirnseelrgkaieqlekararlkkvemdadqfrvngyseierekmnlinstyktleq
    fenyknetiqfeqqkainqvrqrvfqqalqgalgtlnsclnnelhlrtinanigmfgamn
    eitd
    

    Sequence, based on observed residues (ATOM records):
    >6fkib (b:)
    fntdilatnlinlsvvlgvliffgkgvlsdlldnrkqrilntirnseelrgkaieqleka
    rarlkkvemdadqfrvngyseierekmnlinstyktleqfenyknetiqfeqqkainqvr
    qrvfqqalqgalgtlnsclnnelhlrtinanigmfgamnei
    

  • Chain 'd':
    Sequence, based on SEQRES records:
    >6fkid (d:)
    maalqnpvalqsrtttavaalstssttstpkpfslsfssstatfnplrlkiltaskltak
    prggalgtrmvdstasryasaladvadvtgtleatnsdveklirifseepvyyffanpvi
    sidnkrsvldeiittsglqphtanfinilidserinlvkeilnefedvfnkitgtevavv
    tsvvklendhlaqiakgvqkitgaknvriktvidpslvagftirygnegsklvdmsvkkq
    leeiaaqlemddvtlav
    

    Sequence, based on observed residues (ATOM records):
    >6fkid (d:)
    vdstasryasaladvadvtgtleatnsdveklirifseepvyyffanpvisidnkrsvld
    eiittsglqphtanfinilidserinlvkeilnefedvfnkitgtevavvtsvvklendh
    laqiakgvqkitgaknvriktvidpslvagftirygnegsklvdmsvkkqleeiaaqle
    

  • Chain 'e':
    Sequence, based on SEQRES records:
    >6fkie (e:)
    mtlnlcvltpnrsiwnsevkeiilstnsgqigvlpnhaptatavdigilrirlndqwltl
    almggfarignneitilvndaergsdidpqeaqqtleiaeanlrkaegkrqkieanlalr
    rartrveasntiss
    

    Sequence, based on observed residues (ATOM records):
    >6fkie (e:)
    mtlnlcvltpnrsiwnsevkeiilstnsgqigvlpnhaptatavdigilrirlndqwltl
    almggfarignneitilvndaergsdidpqeaqqtleiaeanlrkaegkrqkieanlalr
    rartrveasnt
    

  • Chain 'g':
    Sequence, based on SEQRES records:
    >6fkig (g:)
    macslsfsssvstfhlptttqstqappnnattlpttnpiqcanlrelrdrigsvkntqki
    teamklvaaakvrraqeavvngrpfsetlvevlynmneqlqtedvdvpltkirtvkkval
    mvvtgdrglcggfnnmllkkaesriaelkklgvdytiisigkkgntyfirrpeipvdryf
    dgtnlptakeaqaiaddvfslfvseevdkvemlytkfvslvksdpvihtllplspkgeic
    dingkcvdaaedelfrlttkegkltverdmiktetpafspilefeqdpaqildallplyl
    nsqilralqeslaselaarmtamsnatdnanelkktlsinynrarqakitgeileivaga
    nacv
    

    Sequence, based on observed residues (ATOM records):
    >6fkig (g:)
    nlrelrdrigsvkntqkiteamklvaaakvrraqeavvngrpfsetlvevlynmneqlqt
    edvdvpltkirtvkkvalmvvtgdrglcggfnnmllkkaesriaelkklgvdytiisigk
    kgntyfirrpeipvdryfdgtnlptakeaqaiaddvfslfvseevdkvemlytkfvslvk
    sdpvihtllplspkgeicdingkcvdaaedelfrlttkegkltverdmiktetpafspil
    efeqdpaqildallplylnsqilralqeslaselaarmtamsnatdnanelkktlsinyn
    rarqakitgeileivaganac
    

  • Chain 'p':
    Sequence, based on SEQRES records:
    >6fkip (p:)
    manmlvasssktlpttttttitpkpkfpllktpllklsppqlpplkhlnlsvlksaaita
    tpltlsfllpypslaeeiekaslfdfnltlpiimaeflflmfaldkiyytplgdfmdkrd
    asikeqlsgvkdtssevkqleeqanavmraaraeisaalnkmkketqleveaklaegrkk
    ievelqealgsleqqkedtiksldsqisalsddivkkvlpvs
    

    Sequence, based on observed residues (ATOM records):
    >6fkip (p:)
    iekaslfdfnltlpiimaeflflmfaldkiyytplgdfmdkrdasikeqlsgvkdtssev
    kqleeqanavmraaraeisaalnkmkketqleveaklaegrkkievelqealgsleqqke
    dtiksldsqisalsddivkkvlp