PDB entry 6fkb

View 6fkb on RCSB PDB site
Description: Crystal structure of N2C/D282C stabilized opsin bound to RS13
Class: membrane protein
Keywords: rhodopsin, g protein-coupled receptors, retinitis pigmentosa, signaling protein, sensory transduction, photoreceptor protein, kintegral membrane protein, vision, membrane, receptor, transducer photoreceptor, small molecule complex, membrane protein
Deposited on 2018-01-23, released 2018-04-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 3.03 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: rhodopsin
  Species: Bos taurus [TaxId:9913]
  Gene: RHO
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02699 (0-327)
    • conflict (1)
    • conflict (281)
  Domains in SCOPe 2.08: d6fkba_
• Heterogens: PLM, NAG, BMA, MAN, BOG, DLH, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6fkbA (A:)
  mcgtegpnfyvpfsnktgvvrspfeapqyylaepwqfsmlaaymfllimlgfpinfltly
  vtvqhkklrtplnyillnlavadlfmvfggftttlytslhgyfvfgptgcnlegffatlg
  geialwslvvlaieryvvvckpmsnfrfgenhaimgvaftwvmalacaapplvgwsryip
  egmqcscgidyytpheetnnesfviymfvvhfiipliviffcygqlvftvkeaaaqqqes
  attqkaekevtrmviimviaflicwlpyagvafyifthqgscfgpifmtipaffaktsav
  ynpviyimmnkqfrncmvttlccgknpl