PDB entry 6fk6

View 6fk6 on RCSB PDB site
Description: Crystal structure of N2C/D282C stabilized opsin bound to RS01
Class: membrane protein
Keywords: rhodopsin, g protein-coupled receptors, retinitis pigmentosa, signaling protein, sensory transduction, photoreceptor protein, kintegral membrane protein, vision, membrane, receptor, transducer photoreceptor, small molecule complex, membrane protein
Deposited on 2018-01-23, released 2018-04-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.36 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rhodopsin
    Species: Bos taurus [TaxId:9913]
    Gene: RHO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02699 (0-325)
      • conflict (1)
      • conflict (281)
    Domains in SCOPe 2.08: d6fk6a_
  • Heterogens: PLM, BOG, DOK, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fk6A (A:)
    mcgtegpnfyvpfsnktgvvrspfeapqyylaepwqfsmlaaymfllimlgfpinfltly
    vtvqhkklrtplnyillnlavadlfmvfggftttlytslhgyfvfgptgcnlegffatlg
    geialwslvvlaieryvvvckpmsnfrfgenhaimgvaftwvmalacaapplvgwsryip
    egmqcscgidyytpheetnnesfviymfvvhfiipliviffcygqlvftvkeaaaqqqes
    attqkaekevtrmviimviaflicwlpyagvafyifthqgscfgpifmtipaffaktsav
    ynpviyimmnkqfrncmvttlccgkn