PDB entry 6fk1

View 6fk1 on RCSB PDB site
Description: Cyclophilin A
Class: isomerase
Keywords: Cyclophilin, PPiase, Isomerase, Chaperone
Deposited on 2018-01-23, released 2019-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-06, with a file datestamp of 2019-02-01.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-prolyl cis-trans isomerase A
    Species: Mus musculus [TaxId:10090]
    Gene: PPIA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17742 (0-163)
      • expression tag (164-167)
    Domains in SCOPe 2.07: d6fk1a1, d6fk1a2
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fk1A (A:)
    mvnptvffditaddeplgrvsfelfadkvpktaenfralstgekgfgykgssfhriipgf
    mcqggdftrhngtggrsiygekfedenfilkhtgpgilsmanagpntngsqffictakte
    wldgkhvvfgkvkegmniveamerfgsrngktskkitisdcgqllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fk1A (A:)
    mvnptvffditaddeplgrvsfelfadkvpktaenfralstgekgfgykgssfhriipgf
    mcqggdftrhngtggrsiygekfedenfilkhtgpgilsmanagpntngsqffictakte
    wldgkhvvfgkvkegmniveamerfgsrngktskkitisdcgqllehh