PDB entry 6fk0

View 6fk0 on RCSB PDB site
Description: Xray structure of domain-swapped cystatin E dimer
Class: hydrolase inhibitor
Keywords: inhibitor, domain swapping, amyloid fibril, legumain, cathepsin, cysteine protease, hydrolase inhibitor
Deposited on 2018-01-23, released 2018-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-11, with a file datestamp of 2018-07-06.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cystatin-M
    Species: Homo sapiens [TaxId:9606]
    Gene: CST6
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15828 (Start-122)
      • expression tag (123)
    Domains in SCOPe 2.07: d6fk0a1, d6fk0a2
  • Chain 'B':
    Compound: cystatin-M
    Species: Homo sapiens [TaxId:9606]
    Gene: CST6
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15828 (Start-122)
      • expression tag (123-124)
    Domains in SCOPe 2.07: d6fk0b1, d6fk0b2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fk0A (A:)
    mdrpqermvgelrdlspddpqvqkaaqaavasynmgsnsiyyfrdthiikaqsqlvagik
    yfltmemgstdcrktrvtgdhvdlttcplaagaqqeklrcdfevlvvpwqnssqllkhnc
    vqmlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fk0A (A:)
    vgelrdlspddpqvqkaaqaavasynmgsnsiyyfrdthiikaqsqlvagikyfltmemg
    stdcrktgdhvdlttcplaagaqqeklrcdfevlvvpwqnssqllkhncvqml
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6fk0B (B:)
    mdrpqermvgelrdlspddpqvqkaaqaavasynmgsnsiyyfrdthiikaqsqlvagik
    yfltmemgstdcrktrvtgdhvdlttcplaagaqqeklrcdfevlvvpwqnssqllkhnc
    vqmlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fk0B (B:)
    vgelrdlspddpqvqkaaqaavasynmgsnsiyyfrdthiikaqsqlvagikyfltmemg
    stdcrktvdlttcplaagaqqeklrcdfevlvvpwqnssqllkhncvqmle