PDB entry 6fjt

View 6fjt on RCSB PDB site
Description: 4-chloro-benzamidine in complex with thrombin
Deposited on 2018-01-23, released 2019-02-06
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.27 Å
R-factor: N/A
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Prothrombin
    Species: Homo sapiens [TaxId:9606]
    Gene: F2
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: Hirudin variant-2
    Species: Hirudo medicinalis [TaxId:6421]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FJT (0-10)
  • Chain 'L':
    Compound: Prothrombin
    Species: Homo sapiens [TaxId:9606]
    Gene: F2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: DKQ, NAG, NA, DMS, PO4, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records:
    >6fjtH (H:)
ivegsdaeigmspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftendll
vrigkhsrtryerniekismlekiyihprynwrenldrdialmklkkpvafsdyihpvcl
pdretaasllqagykgrvtgwgnlketgqpsvlqvvnlpiverpvckdstriritdnmfc
agykpdegkrgdacegdsggpfvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlk
kwiqkvidqfg

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records:
    >6fjtI (I:)
dfeeipeeylq

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records:
    >6fjtL (L:)
eadcglrplfekksledkterellesyi