PDB entry 6fjs

View 6fjs on RCSB PDB site
Description: Proteinase~K SIRAS phased structure of room-temperature, serially collected synchrotron data
Class: hydrolase
Keywords: Hydrolase, Protease, Serine protease
Deposited on 2018-01-23, released 2018-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-10, with a file datestamp of 2018-10-05.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proteinase K
    Species: Parengyodontium album [TaxId:37998]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06873 (0-278)
      • conflict (206)
    Domains in SCOPe 2.07: d6fjsa_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fjsA (A:)
    aaqtnapwglarisstspgtstyyydesagqgscvyvidtgieashpefegraqmvktyy
    yssrdgnghgthcagtvgsrtygvakktqlfgvkvlddngsgqystiiagmdfvasdknn
    rncpkgvvaslslgggysssvnsaaarlqssgvmvavaagnnnadarnyspasepsvctv
    gasdrydrrssfsnygsvldifgpgtdilstwiggstrsisgtsmatphvaglaaylmtl
    gkttaasacryiadtankgdlsnipfgtvnllaynnyqa