PDB entry 6fjq

View 6fjq on RCSB PDB site
Description: Adenovirus species 48, fiber knob protein
Class: viral protein
Keywords: Fiber, Fiber-knob, tropism determinant, high resolution, structure determination. adenovirus, Mastadenovirus, VIRAL PROTEIN
Deposited on 2018-01-22, released 2019-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-06, with a file datestamp of 2019-02-01.
Experiment type: XRAY
Resolution: 2.91 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fiber
    Species: Human adenovirus 48 [TaxId:39641]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A4ZKK6 (0-194)
      • conflict (1-2)
    Domains in SCOPe 2.07: d6fjqa_
  • Chain 'B':
    Compound: Fiber
    Species: Human adenovirus 48 [TaxId:39641]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A4ZKK6 (0-194)
      • conflict (1-2)
    Domains in SCOPe 2.07: d6fjqb_
  • Heterogens: EDO, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fjqA (A:)
    dkltlwttpdpspnckidqdkdskltfvltkcgsqilanmsllvvkgkfsminnkvngtd
    dykkftikllfdekgvllkdssldkeywnyrsnnnnvgsayeeavgfmpsttaypkpptp
    ptnpttpleksqaknkyvsnvylggqagnpvattvsfnketgctysitfdfawnktyenv
    qfdssfltfsyiaqe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fjqB (B:)
    dkltlwttpdpspnckidqdkdskltfvltkcgsqilanmsllvvkgkfsminnkvngtd
    dykkftikllfdekgvllkdssldkeywnyrsnnnnvgsayeeavgfmpsttaypkpptp
    ptnpttpleksqaknkyvsnvylggqagnpvattvsfnketgctysitfdfawnktyenv
    qfdssfltfsyiaqe