PDB entry 6fjo

View 6fjo on RCSB PDB site
Description: Adenovirus species 26 knob protein, very high resolution
Class: viral protein
Keywords: Fiber, Fiber-knob, tropism determinant, high resolution, structure determination. adenovirus, Mastadenovirus, VIRAL PROTEIN
Deposited on 2018-01-22, released 2019-02-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-09-25, with a file datestamp of 2019-09-20.
Experiment type: XRAY
Resolution: 1.17 Å
R-factor: N/A
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fiber
    Species: Human adenovirus 26 [TaxId:46928]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6fjoa_
  • Heterogens: GLU, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6fjoA (A:)
rrtlwttpdtspnckmstekdskltltltkcgsqvlgnvsllavtgeyhqmtattkkdvk
isllfdengillpssslskdywnyrsddsivsqkynnavpfmpnltaypkpsaqnaknys
rtkiisnvylgaltyqpviitiafnqetengcaysitftftwqkdysaqqfdvtsftfsy
ltq