PDB entry 6fjj

View 6fjj on RCSB PDB site
Description: Joint neutron and x-ray crystal structure of human carbonic anhydrase IX mimic (saccharin).
Class: lyase
Keywords: joint X-ray neutron diffraction, carbonic anhydrase, LYASE
Deposited on 2018-01-22, released 2019-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-06, with a file datestamp of 2019-02-01.
Experiment type: XRAYNEUT
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbonic anhydrase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00918 (Start-259)
      • engineered mutation (64)
      • engineered mutation (66)
      • engineered mutation (68)
      • engineered mutation (90)
      • engineered mutation (129)
      • engineered mutation (168)
      • engineered mutation (202)
    Domains in SCOPe 2.07: d6fjja_
  • Heterogens: ZN, LSA, DOD

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fjjA (A:)
    mshhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslril
    nnghsfqvtfddsqdkavlkggpldgtyrllqfhfhwgsldgqgsehtvdkkkyaaelhl
    vhwntkygdvgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktegksadftnfdp
    rgllpesldywtypgslttpplaecvtwivlkepisvsseqvlkfrklnfngegepeelm
    vdnwrpaqplknrqikasfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fjjA (A:)
    hhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnn
    ghsfqvtfddsqdkavlkggpldgtyrllqfhfhwgsldgqgsehtvdkkkyaaelhlvh
    wntkygdvgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktegksadftnfdprg
    llpesldywtypgslttpplaecvtwivlkepisvsseqvlkfrklnfngegepeelmvd
    nwrpaqplknrqikasfk