PDB entry 6fj1

View 6fj1 on RCSB PDB site
Description: Structure of the Ldtfm-avibactam carbamoyl enzyme
Class: hydrolase
Keywords: L, D-TRANSPEPTIDATION, PEPTIDOGLYCAN, ANTIBIOTIC RESISTANCE, AVIBACTAM, NXL104, ANTIBIOTIC, hydrolase
Deposited on 2018-01-19, released 2019-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 2.69 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L,D-transpeptidase
    Species: Enterococcus faecium [TaxId:1352]
    Gene: CQR42_01530
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A2D0BNR1 (1-249)
      • expression tag (0)
      • expression tag (250-252)
    Domains in SCOPe 2.07: d6fj1a1, d6fj1a2, d6fj1a3, d6fj1a4
  • Chain 'B':
    Compound: L,D-transpeptidase
    Species: Enterococcus faecium [TaxId:1352]
    Gene: CQR42_01530
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A2D0BNR1 (1-249)
      • expression tag (0)
      • expression tag (250-252)
    Domains in SCOPe 2.07: d6fj1b1, d6fj1b2, d6fj1b3, d6fj1b4
  • Chain 'C':
    Compound: L,D-transpeptidase
    Species: Enterococcus faecium [TaxId:1352]
    Gene: CQR42_01530
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A2D0BNR1 (1-249)
      • expression tag (0)
      • expression tag (250-252)
    Domains in SCOPe 2.07: d6fj1c1, d6fj1c2, d6fj1c3, d6fj1c4
  • Heterogens: P3G, NXL, GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fj1A (A:)
    glkeqlasmnaianvkatysingetfqipssdimswltyndgkvdldteqvrqyvtdlgt
    kyntstndtkfkstkrgevtvpvgtyswtiqtdsetealkkailagqdftrspivqggtt
    adhpliedtyievdlenqhmwyykdgkvaletdivsgkpttptpagvfyvwnkeedatlk
    gtngtpyespvnywmpidwtgvgihdsdwqpeyggdlwktrgshgcintppsvmkelfgm
    vekgtpvlvfgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fj1A (A:)
    glkeqlasmnaianvkatysingetfqipssdimswltyndgkvdldteqvrqyvtdlgt
    kyntstndtkfkstkrgevtvpvgtyswtiqtdsetealkkailagqdftrspivqggtt
    adhpliedtyievdlenqhmwyykdgkvaletdivsgkpttptpagvfyvwnkeedatlk
    gtngtpyespvnywmpidwtgvgihdsdwqpeyggdlwktrgshgcintppsvmkelfgm
    vekgtpvlvfgsh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6fj1B (B:)
    glkeqlasmnaianvkatysingetfqipssdimswltyndgkvdldteqvrqyvtdlgt
    kyntstndtkfkstkrgevtvpvgtyswtiqtdsetealkkailagqdftrspivqggtt
    adhpliedtyievdlenqhmwyykdgkvaletdivsgkpttptpagvfyvwnkeedatlk
    gtngtpyespvnywmpidwtgvgihdsdwqpeyggdlwktrgshgcintppsvmkelfgm
    vekgtpvlvfgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fj1B (B:)
    glkeqlasmnaianvkatysingetfqipssdimswltyndgkvdldteqvrqyvtdlgt
    kyntstndtkfkstkrgevtvpvgtyswtiqtdsetealkkailagqdftrspivqggtt
    adhpliedtyievdlenqhmwyykdgkvaletdivsgkpttptpagvfyvwnkeedatlk
    gtngtpyespvnywmpidwtgvgihdsdwqpeyggdlwktrgshgcintppsvmkelfgm
    vekgtpvlvfgsh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6fj1C (C:)
    glkeqlasmnaianvkatysingetfqipssdimswltyndgkvdldteqvrqyvtdlgt
    kyntstndtkfkstkrgevtvpvgtyswtiqtdsetealkkailagqdftrspivqggtt
    adhpliedtyievdlenqhmwyykdgkvaletdivsgkpttptpagvfyvwnkeedatlk
    gtngtpyespvnywmpidwtgvgihdsdwqpeyggdlwktrgshgcintppsvmkelfgm
    vekgtpvlvfgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fj1C (C:)
    glkeqlasmnaianvkatysingetfqipssdimswltyndgkvdldteqvrqyvtdlgt
    kyntstndtkfkstkrgevtvpvgtyswtiqtdsetealkkailagqdftrspivqggtt
    adhpliedtyievdlenqhmwyykdgkvaletdivsgkpttptpagvfyvwnkeedatlk
    gtngtpyespvnywmpidwtgvgihdsdwqpeyggdlwktrgshgcintppsvmkelfgm
    vekgtpvlvfgsh