PDB entry 6fiy

View 6fiy on RCSB PDB site
Description: Crystal structure of a dye-decolorizing peroxidase D143AR232A variant from Klebsiella pneumoniae (KpDyP)
Class: oxidoreductase
Keywords: alpha-beta barrel, heme binding, DyP, enzymatic redox reaction, OXIDOREDUCTASE
Deposited on 2018-01-19, released 2018-08-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-08, with a file datestamp of 2018-08-03.
Experiment type: XRAY
Resolution: 1.09 Å
R-factor: N/A
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Iron-dependent peroxidase
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: yfeX, AGG09_21550, B1727_13990, B8011_07420, BL102_0001560, BN49_3985, BVX91_12125, CEO55_07245, CIT28_09840, CP905_14695, PMK1_00271, SAMEA3531778_01640, SM57_03027
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0W8ATM9 (Start-301)
      • conflict (145)
      • conflict (234)
      • expression tag (302)
    Domains in SCOPe 2.07: d6fiya1, d6fiya2
  • Chain 'B':
    Compound: Iron-dependent peroxidase
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: yfeX, AGG09_21550, B1727_13990, B8011_07420, BL102_0001560, BN49_3985, BVX91_12125, CEO55_07245, CIT28_09840, CP905_14695, PMK1_00271, SAMEA3531778_01640, SM57_03027
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0W8ATM9 (3-301)
      • expression tag (0-2)
      • conflict (145)
      • conflict (234)
      • expression tag (302)
    Domains in SCOPe 2.07: d6fiyb1, d6fiyb2, d6fiyb3
  • Heterogens: HEM, GOL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fiyA (A:)
    plgmsqvqsgilpehcraaiwieanlkgdvnalreaskifvdnvatfqakfpdaklgavv
    afgnnvwrqlsggegadelkdfpvygkglapstqydllihilsarhevnfsvaqaalaaf
    gdaidvkeeihgfrwveerdlsgfvagtenpageetrrevavikdgvdaggsyvfvqrwe
    hnlkqlnrmsvpdqemmigrtkdaneeidgderpvtshlsrvdlkedgkglkivaqslpy
    gtasgthglyfcaycarlynieqqllsmfgdtdgkrdamlrftkpvtggyyfapsleriq
    alg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fiyA (A:)
    sqvqsgilpehcraaiwieanlkgdvnalreaskifvdnvatfqakfpdaklgavvafgn
    nvwrqlsggegadelkdfpvygkglapstqydllihilsarhevnfsvaqaalaafgdai
    dvkeeihgfrwveerdlsgfvagtenpageetrrevavikdgvdaggsyvfvqrwehnlk
    qlnrmsvpdqemmigrtkdaneeidgderpvtshlsrvdlkedgkglkivaqslpygtas
    gthglyfcaycarlynieqqllsmfgdtdgkrdamlrftkpvtggyyfapsleriqalg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fiyB (B:)
    plgmsqvqsgilpehcraaiwieanlkgdvnalreaskifvdnvatfqakfpdaklgavv
    afgnnvwrqlsggegadelkdfpvygkglapstqydllihilsarhevnfsvaqaalaaf
    gdaidvkeeihgfrwveerdlsgfvagtenpageetrrevavikdgvdaggsyvfvqrwe
    hnlkqlnrmsvpdqemmigrtkdaneeidgderpvtshlsrvdlkedgkglkivaqslpy
    gtasgthglyfcaycarlynieqqllsmfgdtdgkrdamlrftkpvtggyyfapsleriq
    alg