PDB entry 6fiv

View 6fiv on RCSB PDB site
Description: structural studies of hiv and fiv proteases complexed with an efficient inhibitor of fiv pr
Class: hydrolase/hydrolase inhibitor
Keywords: fiv protease, hydrolase-hydrolase inhibitor complex
Deposited on 1998-12-02, released 1998-12-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.155
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: retropepsin
    Species: Feline immunodeficiency virus [TaxId:11674]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16088 (Start-112)
      • conflict (95)
    Domains in SCOPe 2.08: d6fiva_
  • Heterogens: SO4, 3TL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6fivA (A:)
vgttttlekrpeilifvngypikflldtgaditilnrrdfqvknsiengrqnmigvgggk
rgtnyinvhleirdenyktqcifgnvcvlednslivpllgrdnmikfnirlvm

    Sequence, based on observed residues (ATOM records): (download) 
    >6fivA (A:)
gttttlekrpeilifvngypikflldtgaditilnrrdfqvknsiengrqnmigvgggkr
gtnyinvhleirdenyktqcifgnvcvlednslivpllgrdnmikfnirlvm