PDB entry 6fiu

View 6fiu on RCSB PDB site
Description: human cytosolic 5'-nucleotidase ii soaked with 10mm 2-(6-([1,1'- biphenyl]-3-carboxamido)-9h-purin-9-yl)acetic acid
Deposited on 2018-01-19, released 2019-01-30
The last revision was dated 2019-03-06, with a file datestamp of 2019-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytosolic purine 5'-nucleotidase
    Species: Homo sapiens [TaxId:9606]
    Gene: NT5C2, NT5B, NT5CP, PNT5
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, GOL, MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6fiuA (A:)
    mstswsdrlqnaadmpanmdkhalkkyrreayhrvfvnrslamekikcfgfdmdytlavy
    kspeyeslgfeltverlvsigypqellsfaydstfptrglvfdtlygnllkvdaygnllv
    cahgfnfirgpetreqypnkfiqrddterfyilntlfnlpetyllaclvdfftncpryts
    cetgfkdgdlfmsyrsmfqdvrdavdwvhykgslkektvenlekyvvkdgklplllsrmk
    evgkvflatnsdykytdkimtylfdfphgpkpgsshrpwqsyfdlilvdarkplffgegt
    vlrqvdtktgklkigtytgplqhgivysggssdticdllgakgkdilyigdhifgdilks
    kkrqgwrtflvipelaqelhvwtdksslfeelqsldiflaelykhldsssnerpdissiq
    rrikkvthdmdmcygmmgslfrsgsrqtlfasqvmryadlyaasfinllyypfsylfraa
    hvlmphestvehthvdinemesplatrnrtsvdfkdtdykrhqltrsiseikppnl
    

    Sequence, based on observed residues (ATOM records):
    >6fiuA (A:)
    tswsdrlqnaadmpanmdkhalkkyrreayhrvfvnrslamekikcfgfdmdytlavyks
    peyeslgfeltverlvsigypqellsfaydstfptrglvfdtlygnllkvdaygnllvca
    hgfnfirgpetreqypnkfiqrddterfyilntlfnlpetyllaclvdfftncprytsce
    tgfkdgdlfmsyrsmfqdvrdavdwvhykgslkektvenlekyvvkdgklplllsrmkev
    gkvflatnsdykytdkimtylfdfphgpkpgsshrpwqsyfdlilvdarkplffgegtvl
    rqvdtktgklkigtytgplqhgivysggssdticdllgakgkdilyigdhifgdilkskk
    rqgwrtflvipelaqelhvwtdksslfeelqsldiflaeissiqrrikkvthdmdmcygm
    mgslfrsgsrqtlfasqvmryadlyaasfinllyypfsylfraahvlmphes