PDB entry 6fif

View 6fif on RCSB PDB site
Description: crystal structure of the bri1 gly644-asp (bri1-6) mutant from arabidopsis thaliana.
Deposited on 2018-01-18, released 2018-01-31
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.54 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein BRASSINOSTEROID INSENSITIVE 1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: BRI1, At4g39400, F23K16.30
    Database cross-references and differences (RAF-indexed):
    • Uniprot O22476
      • conflict (643)
  • Heterogens: NAG, EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6fifA (A:)
    mktfssfflsvttlfffsffslsfqaspsqslyreihqlisfkdvlpdknllpdwssnkn
    pctfdgvtcrddkvtsidlsskplnvgfsavsssllsltgleslflsnshingsvsgfkc
    sasltsldlsrnslsgpvttltslgscsglkflnvssntldfpgkvsgglklnslevldl
    sansisganvvgwvlsdgcgelkhlaisgnkisgdvdvsrcvnlefldvssnnfstgipf
    lgdcsalqhldisgnklsgdfsraistctelkllnissnqfvgpipplplkslqylslae
    nkftgeipdflsgacdtltgldlsgnhfygavppffgscslleslalssnnfsgelpmdt
    llkmrglkvldlsfnefsgelpesltnlsaslltldlssnnfsgpilpnlcqnpkntlqe
    lylqnngftgkipptlsncselvslhlsfnylsgtipsslgslsklrdlklwlnmlegei
    pqelmyvktletlildfndltgeipsglsnctnlnwislsnnrltgeipkwigrlenlai
    lklsnnsfsgnipaelgdcrsliwldlntnlfngtipaamfkqsgkiaanfiagkryvyi
    kndgmkkechgagnllefqgirseqlnrlstrnpcnitsrvygdhtsptfdnngsmmfld
    msynmlsgyipkeigsmpylfilnlghndisgsipdevgdlrglnildlssnkldgripq
    amsaltmlteidlsnnnlsgpipemgqfetfppakflnnpglcgyplprcdpsnadgyah
    hqrshgrrlenlyfqgsawshpqfekgggsgggsggsawshpqfekgahhhhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6fifA (A:)
    sqslyreihqlisfkdvlpdknllpdwssnknpctfdgvtcrddkvtsidlsskplnvgf
    savsssllsltgleslflsnshingsvsgfkcsasltsldlsrnslsgpvttltslgscs
    glkflnvssntldfpgkvsgglklnslevldlsansisganvvgwvlsdgcgelkhlais
    gnkisgdvdvsrcvnlefldvssnnfstgipflgdcsalqhldisgnklsgdfsraistc
    telkllnissnqfvgpipplplkslqylslaenkftgeipdflsgacdtltgldlsgnhf
    ygavppffgscslleslalssnnfsgelpmdtllkmrglkvldlsfnefsgelpesltnl
    saslltldlssnnfsgpilpnlcqnpkntlqelylqnngftgkipptlsncselvslhls
    fnylsgtipsslgslsklrdlklwlnmlegeipqelmyvktletlildfndltgeipsgl
    snctnlnwislsnnrltgeipkwigrlenlailklsnnsfsgnipaelgdcrsliwldln
    tnlfngtipaamfkqsgkiaanfiagkryvyikndgmkkechgagnllefqgirseqlnr
    lstrnpcnitsrvygdhtsptfdnngsmmfldmsynmlsgyipkeigsmpylfilnlghn
    disgsipdevgdlrglnildlssnkldgripqamsaltmlteidlsnnnlsgpipemgqf
    etfppakflnnpglcgyplprcdp