PDB entry 6fi7

View 6fi7 on RCSB PDB site
Description: e.coli sigma factor s (rpos) region 4
Deposited on 2018-01-17, released 2018-06-06
The last revision was dated 2018-06-13, with a file datestamp of 2018-06-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA polymerase sigma factor RpoS
    Species: Escherichia coli [TaxId:83333]
    Gene: rpoS, appR, katF, nur, otsX, sigS, b2741, JW5437
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6fi7A (A:)
gpedttqdddmkqsivkwlfelnakqrevlarrfgllgyeaatledvgreigltrervrq
iqveglrrlreilqtqglniealfre